| UniProt ID | ZFPL1_HUMAN | |
|---|---|---|
| UniProt AC | O95159 | |
| Protein Name | Zinc finger protein-like 1 | |
| Gene Name | ZFPL1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 310 | |
| Subcellular Localization |
Golgi apparatus, cis-Golgi network membrane Single-pass membrane protein . |
|
| Protein Description | Required for cis-Golgi integrity and efficient ER to Golgi transport. Involved in the maintenance of the integrity of the cis-Golgi, possibly via its interaction with GOLGA2/GM130.. | |
| Protein Sequence | MGLCKCPKRKVTNLFCFEHRVNVCEHCLVANHAKCIVQSYLQWLQDSDYNPNCRLCNIPLASRETTRLVCYDLFHWACLNERAAQLPRNTAPAGYQCPSCNGPIFPPTNLAGPVASALREKLATVNWARAGLGLPLIDEVVSPEPEPLNTSDFSDWSSFNASSTPGPEEVDSASAAPAFYSQAPRPPASPGRPEQHTVIHMGNPEPLTHAPRKVYDTRDDDRTPGLHGDCDDDKYRRRPALGWLARLLRSRAGSRKRPLTLLQRAGLLLLLGLLGFLALLALMSRLGRAAADSDPNLDPLMNPHIRVGPS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Malonylation | LCKCPKRKVTNLFCF CCCCCCCCCEEEECC | 60.58 | 26320211 | |
| 121 | Ubiquitination | VASALREKLATVNWA HHHHHHHHHHHHHHH | 36.67 | - | |
| 121 | 2-Hydroxyisobutyrylation | VASALREKLATVNWA HHHHHHHHHHHHHHH | 36.67 | - | |
| 181 | Phosphorylation | SAAPAFYSQAPRPPA HHCCCHHCCCCCCCC | 17.26 | 26074081 | |
| 189 | Phosphorylation | QAPRPPASPGRPEQH CCCCCCCCCCCCCCC | 33.39 | 26074081 | |
| 197 | Phosphorylation | PGRPEQHTVIHMGNP CCCCCCCEEEECCCC | 22.35 | 26074081 | |
| 208 | Phosphorylation | MGNPEPLTHAPRKVY CCCCCCCCCCCCEEE | 27.06 | 26471730 | |
| 215 | Phosphorylation | THAPRKVYDTRDDDR CCCCCEEECCCCCCC | 18.03 | - | |
| 217 | Phosphorylation | APRKVYDTRDDDRTP CCCEEECCCCCCCCC | 20.50 | - | |
| 223 | Phosphorylation | DTRDDDRTPGLHGDC CCCCCCCCCCCCCCC | 28.80 | 30576142 | |
| 234 | Acetylation | HGDCDDDKYRRRPAL CCCCCCHHHHHCHHH | 47.88 | 25825284 | |
| 235 | Phosphorylation | GDCDDDKYRRRPALG CCCCCHHHHHCHHHH | 19.15 | 25839225 | |
| 260 | Phosphorylation | GSRKRPLTLLQRAGL CCCCCCHHHHHHHHH | 28.27 | 23612710 | |
| 310 | O-linked_Glycosylation | PHIRVGPS------- CCCCCCCC------- | 47.10 | 55834437 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZFPL1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZFPL1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZFPL1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| OSBL3_HUMAN | OSBPL3 | physical | 28514442 | |
| ACBD5_HUMAN | ACBD5 | physical | 28514442 | |
| ERGI2_HUMAN | ERGIC2 | physical | 28514442 | |
| OSBL6_HUMAN | OSBPL6 | physical | 28514442 | |
| 2A5E_HUMAN | PPP2R5E | physical | 28514442 | |
| ERGI3_HUMAN | ERGIC3 | physical | 28514442 | |
| JIP4_HUMAN | SPAG9 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
