| UniProt ID | ERGI3_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y282 | |
| Protein Name | Endoplasmic reticulum-Golgi intermediate compartment protein 3 | |
| Gene Name | ERGIC3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 383 | |
| Subcellular Localization |
Endoplasmic reticulum-Golgi intermediate compartment membrane Multi-pass membrane protein . Golgi apparatus, cis-Golgi network membrane Multi-pass membrane protein . Endoplasmic reticulum membrane Multi-pass membrane protein . Cycles between th |
|
| Protein Description | Possible role in transport between endoplasmic reticulum and Golgi.. | |
| Protein Sequence | MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MEALGKLK -------CCCCHHHH | 6.49 | 25944712 | |
| 6 | 2-Hydroxyisobutyrylation | --MEALGKLKQFDAY --CCCCHHHHHCCCC | 54.05 | - | |
| 6 | Ubiquitination | --MEALGKLKQFDAY --CCCCHHHHHCCCC | 54.05 | - | |
| 8 | Ubiquitination | MEALGKLKQFDAYPK CCCCHHHHHCCCCCC | 53.02 | 21890473 | |
| 8 | 2-Hydroxyisobutyrylation | MEALGKLKQFDAYPK CCCCHHHHHCCCCCC | 53.02 | - | |
| 8 (in isoform 1) | Ubiquitination | - | 53.02 | 21890473 | |
| 8 (in isoform 3) | Ubiquitination | - | 53.02 | 21890473 | |
| 8 (in isoform 2) | Ubiquitination | - | 53.02 | 21890473 | |
| 13 | Phosphorylation | KLKQFDAYPKTLEDF HHHHCCCCCCCHHHC | 13.70 | 27762562 | |
| 15 | Ubiquitination | KQFDAYPKTLEDFRV HHCCCCCCCHHHCCC | 53.73 | 21890473 | |
| 15 (in isoform 1) | Ubiquitination | - | 53.73 | 21890473 | |
| 15 (in isoform 3) | Ubiquitination | - | 53.73 | 21890473 | |
| 15 (in isoform 2) | Ubiquitination | - | 53.73 | 21890473 | |
| 83 | Phosphorylation | FPHMPCAYLSIDAMD CCCCCCEEEEEECCC | 14.01 | - | |
| 110 | 2-Hydroxyisobutyrylation | LFKQRLDKDGIPVSS HHHHHCCCCCCCCCC | 63.55 | - | |
| 110 | Ubiquitination | LFKQRLDKDGIPVSS HHHHHCCCCCCCCCC | 63.55 | - | |
| 116 (in isoform 3) | Phosphorylation | - | 19.67 | 27251275 | |
| 116 | Phosphorylation | DKDGIPVSSEAERHE CCCCCCCCCHHHHHC | 19.67 | 29255136 | |
| 117 | Phosphorylation | KDGIPVSSEAERHEL CCCCCCCCHHHHHCC | 40.85 | 29255136 | |
| 126 | Ubiquitination | AERHELGKVEVTVFD HHHHCCCCEEEEEEC | 48.09 | - | |
| 130 | Phosphorylation | ELGKVEVTVFDPDSL CCCCEEEEEECHHHC | 11.27 | 30177828 | |
| 130 | O-linked_Glycosylation | ELGKVEVTVFDPDSL CCCCEEEEEECHHHC | 11.27 | OGP | |
| 136 | Phosphorylation | VTVFDPDSLDPDRCE EEEECHHHCCHHHCC | 39.81 | 30177828 | |
| 174 (in isoform 2) | Ubiquitination | - | 60.88 | 21890473 | |
| 174 (in isoform 1) | Ubiquitination | - | 60.88 | 21890473 | |
| 174 (in isoform 3) | Ubiquitination | - | 60.88 | 21890473 | |
| 174 | Ubiquitination | RRRGWAFKNPDTIEQ HHCCCCCCCHHHHHH | 60.88 | 21906983 | |
| 190 (in isoform 2) | Ubiquitination | - | 41.16 | 21890473 | |
| 190 (in isoform 1) | Ubiquitination | - | 41.16 | 21890473 | |
| 190 (in isoform 3) | Ubiquitination | - | 41.16 | 21890473 | |
| 190 | Sumoylation | RREGFSQKMQEQKNE HHCCHHHHHHHHHCC | 41.16 | - | |
| 190 | Ubiquitination | RREGFSQKMQEQKNE HHCCHHHHHHHHHCC | 41.16 | 1906983 | |
| 190 | Sumoylation | RREGFSQKMQEQKNE HHCCHHHHHHHHHCC | 41.16 | - | |
| 195 | Ubiquitination | SQKMQEQKNEGCQVY HHHHHHHHCCCCEEE | 57.10 | - | |
| 202 | Phosphorylation | KNEGCQVYGFLEVNK HCCCCEEEEEEEEEE | 4.01 | - | |
| 209 | Ubiquitination | YGFLEVNKVAGNFHF EEEEEEEEEECEEEC | 38.34 | - | |
| 241 | N-linked_Glycosylation | SFGLDNINMTHYIQH HCCCCCCCCHHHHHH | 35.24 | 19159218 | |
| 266 | N-linked_Glycosylation | VNPLDHTNVTAPQAS CCCCCCCCCCCCCHH | 26.23 | UniProtKB CARBOHYD | |
| 289 | Ubiquitination | VVPTVYMKVDGEVLR CCCEEEEEECCEEEE | 21.35 | - | |
| 337 | Ubiquitination | MMVKLTEKHRSFTHF HHHHHHHHHHHHHHH | 38.80 | - | |
| 381 | Ubiquitination | QKKIDLGKTT----- HHHHCCCCCC----- | 57.18 | - | |
| 382 | Phosphorylation | KKIDLGKTT------ HHHCCCCCC------ | 35.62 | 21712546 | |
| 383 | Phosphorylation | KIDLGKTT------- HHCCCCCC------- | 39.85 | 21712546 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ERGI3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ERGI3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ERGI3_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry."; Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.; J. Proteome Res. 8:651-661(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-241, AND MASSSPECTROMETRY. | |
