VMP1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VMP1_HUMAN
• UniProt AC: Q96GC9
• Protein Name: Vacuole membrane protein 1
• Gene Name: VMP1
• Organism: Homo sapiens (Human).
• Sequence Length: 406
• Subcellular Localization: Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cell membrane ; Multi-pass membrane protein . Vacuole membrane; Multi-pass membrane protein. Endoplasmic reticulum .
• Protein Description: Stress-induced protein that, when overexpressed, promotes formation of intracellular vacuoles followed by cell death. May be involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis. Plays a role in the initial stages of the autophagic process through its interaction with BECN1 (By similarity). Involved in cell-cell adhesion. Plays an essential role in formation of cell junctions..
• Protein Sequence: MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQYFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLIATYYVEGVHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAENGKNCD ------CCCCCCCCH	20.97	22814378
25	Phosphorylation	EHHNGNFTDPSSVNE CCCCCCCCCHHHHCH	51.50	28555341
28	Phosphorylation	NGNFTDPSSVNEKKR CCCCCCHHHHCHHHH	50.13	28555341
33	Ubiquitination	DPSSVNEKKRREREE CHHHHCHHHHHHHHH	46.51	2190698
33	2-Hydroxyisobutyrylation	DPSSVNEKKRREREE CHHHHCHHHHHHHHH	46.51	-
34	Ubiquitination	PSSVNEKKRREREER HHHHCHHHHHHHHHH	50.97	-
69	Phosphorylation	LVILKEWTSKLWHRQ HHHHHHHHHHHHHHH	19.64	29083192
70	Phosphorylation	VILKEWTSKLWHRQS HHHHHHHHHHHHHHH	27.16	29083192
182	Phosphorylation	EGTISLWSIISKVRI CCCHHHHHHHHHHHH	18.48	24719451
224	Phosphorylation	AEPDDEEYQEFEEML CCCCHHHHHHHHHHH	15.99	28796482
250	Ubiquitination	RAKLAVQKLVQKVGF HHHHHHHHHHHHHCC	43.99	-
378	Phosphorylation	LVVVMVCYFILSIIN HHHHHHHHHHHHHHH	5.13	23401153
382	Phosphorylation	MVCYFILSIINSMAQ HHHHHHHHHHHHHHH	19.33	23401153
386	Phosphorylation	FILSIINSMAQSYAK HHHHHHHHHHHHHHH	12.70	23401153
390	Phosphorylation	IINSMAQSYAKRIQQ HHHHHHHHHHHHHHH	19.95	23401153
404	Ubiquitination	QRLNSEEKTK----- HHHCHHHHCC-----	58.52	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VMP1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VMP1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VMP1_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of VMP1_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.