TM223_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TM223_HUMAN
• UniProt AC: A0PJW6
• Protein Name: Transmembrane protein 223
• Gene Name: TMEM223
• Organism: Homo sapiens (Human).
• Sequence Length: 202
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MAAPWRRWPTGLLAVLRPLLTCRPLQGTTLQRDVLLFEHDRGRFFTILGLFCAGQGVFWASMAVAAVSRPPVPVQPLDAEVPNRGPFDLRSALWRYGLAVGCGAIGALVLGAGLLFSLRSVRSVVLRAGGQQVTLTTHAPFGLGAHFTVPLKQVSCMAHRGEVPAMLPLKVKGRRFYFLLDKTGHFPNTKLFDNTVGAYRSL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Phosphorylation	APWRRWPTGLLAVLR CCCCCCCCHHHHHHH	33.24	24719451
182	Ubiquitination	RFYFLLDKTGHFPNT EEEEEEECCCCCCCC	57.27	21890473
183	Phosphorylation	FYFLLDKTGHFPNTK EEEEEECCCCCCCCC	35.24	29759185
189	Phosphorylation	KTGHFPNTKLFDNTV CCCCCCCCCCCCCCC	29.39	29759185

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TM223_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TM223_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TM223_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MTHR_HUMAN	MTHFR	physical	28514442
CGL_HUMAN	CTH	physical	28514442
TTMP_HUMAN	C3orf52	physical	28514442
1C07_HUMAN	HLA-C	physical	28514442
TR10B_HUMAN	TNFRSF10B	physical	28514442
AT12A_HUMAN	ATP12A	physical	28514442
RBM27_HUMAN	RBM27	physical	28514442
ATP7B_HUMAN	ATP7B	physical	28514442
PTPRD_HUMAN	PTPRD	physical	28514442
SDCB1_HUMAN	SDCBP	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.