UniProt ID | TM223_HUMAN | |
---|---|---|
UniProt AC | A0PJW6 | |
Protein Name | Transmembrane protein 223 | |
Gene Name | TMEM223 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 202 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MAAPWRRWPTGLLAVLRPLLTCRPLQGTTLQRDVLLFEHDRGRFFTILGLFCAGQGVFWASMAVAAVSRPPVPVQPLDAEVPNRGPFDLRSALWRYGLAVGCGAIGALVLGAGLLFSLRSVRSVVLRAGGQQVTLTTHAPFGLGAHFTVPLKQVSCMAHRGEVPAMLPLKVKGRRFYFLLDKTGHFPNTKLFDNTVGAYRSL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | APWRRWPTGLLAVLR CCCCCCCCHHHHHHH | 33.24 | 24719451 | |
182 | Ubiquitination | RFYFLLDKTGHFPNT EEEEEEECCCCCCCC | 57.27 | 21890473 | |
183 | Phosphorylation | FYFLLDKTGHFPNTK EEEEEECCCCCCCCC | 35.24 | 29759185 | |
189 | Phosphorylation | KTGHFPNTKLFDNTV CCCCCCCCCCCCCCC | 29.39 | 29759185 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM223_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM223_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM223_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MTHR_HUMAN | MTHFR | physical | 28514442 | |
CGL_HUMAN | CTH | physical | 28514442 | |
TTMP_HUMAN | C3orf52 | physical | 28514442 | |
1C07_HUMAN | HLA-C | physical | 28514442 | |
TR10B_HUMAN | TNFRSF10B | physical | 28514442 | |
AT12A_HUMAN | ATP12A | physical | 28514442 | |
RBM27_HUMAN | RBM27 | physical | 28514442 | |
ATP7B_HUMAN | ATP7B | physical | 28514442 | |
PTPRD_HUMAN | PTPRD | physical | 28514442 | |
SDCB1_HUMAN | SDCBP | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...