| UniProt ID | SDCB1_HUMAN | |
|---|---|---|
| UniProt AC | O00560 | |
| Protein Name | Syntenin-1 | |
| Gene Name | SDCBP | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 298 | |
| Subcellular Localization |
Cell junction, focal adhesion . Cell junction, adherens junction . Cell membrane Peripheral membrane protein . Endoplasmic reticulum membrane Peripheral membrane protein . Nucleus . Melanosome . Cytoplasm, cytosol . Cytoplasm, cytoskeleton . Secreted, |
|
| Protein Description | Multifunctional adapter protein involved in diverse array of functions including trafficking of transmembrane proteins, neuro and immunomodulation, exosome biogenesis, and tumorigenesis. [PubMed: 26291527 Positively regulates TGFB1-mediated SMAD2/3 activation and TGFB1-induced epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types. May increase TGFB1 signaling by enhancing cell-surface expression of TGFR1 by preventing the interaction between TGFR1 and CAV1 and subsequent CAV1-dependent internalization and degradation of TGFR1] | |
| Protein Sequence | MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSLYPSLED ------CCCCCCHHH | 36.29 | 20068231 | |
| 2 | Acetylation | ------MSLYPSLED ------CCCCCCHHH | 36.29 | 20068231 | |
| 4 | Phosphorylation | ----MSLYPSLEDLK ----CCCCCCHHHCC | 5.40 | 29255136 | |
| 6 | Phosphorylation | --MSLYPSLEDLKVD --CCCCCCHHHCCCC | 30.73 | 29255136 | |
| 6 (in isoform 3) | Phosphorylation | - | 30.73 | 18578522 | |
| 11 | Ubiquitination | YPSLEDLKVDKVIQA CCCHHHCCCCEEEEH | 61.79 | - | |
| 14 (in isoform 2) | Ubiquitination | - | 44.20 | - | |
| 14 | Ubiquitination | LEDLKVDKVIQAQTA HHHCCCCEEEEHHHC | 44.20 | 21906983 | |
| 23 | Phosphorylation | IQAQTAFSANPANPA EEHHHCCCCCCCCHH | 25.36 | 28152594 | |
| 33 | Phosphorylation | PANPAILSEASAPIP CCCHHHHCCCCCCCC | 25.63 | 28152594 | |
| 36 | Phosphorylation | PAILSEASAPIPHDG HHHHCCCCCCCCCCC | 30.44 | 28152594 | |
| 46 | Phosphorylation | IPHDGNLYPRLYPEL CCCCCCCCHHHCHHH | 7.12 | 25159151 | |
| 50 | Phosphorylation | GNLYPRLYPELSQYM CCCCHHHCHHHHHHC | 8.92 | 28348404 | |
| 54 | Phosphorylation | PRLYPELSQYMGLSL HHHCHHHHHHCCCCC | 20.01 | 27273156 | |
| 56 | Phosphorylation | LYPELSQYMGLSLNE HCHHHHHHCCCCCCH | 6.97 | 19605366 | |
| 60 | Phosphorylation | LSQYMGLSLNEEEIR HHHHCCCCCCHHHHH | 24.34 | 21082442 | |
| 74 (in isoform 2) | Phosphorylation | - | 23.73 | 20071362 | |
| 74 | Phosphorylation | RANVAVVSGAPLQGQ HHCEEEEECCCCCCE | 23.73 | 28450419 | |
| 86 (in isoform 2) | Phosphorylation | - | 23.77 | 28348404 | |
| 87 (in isoform 2) | Phosphorylation | - | 37.99 | 24719451 | |
| 87 | Phosphorylation | GQLVARPSSINYMVA CEEEECCCCCCEEEE | 37.99 | 28450419 | |
| 88 | Phosphorylation | QLVARPSSINYMVAP EEEECCCCCCEEEEC | 19.96 | 28450419 | |
| 91 | Phosphorylation | ARPSSINYMVAPVTG ECCCCCCEEEECCCC | 7.41 | 21082442 | |
| 109 | Ubiquitination | GIRRAEIKQGIREVI HHCHHHHHCCCCEEE | 33.70 | - | |
| 119 | Acetylation | IREVILCKDQDGKIG CCEEEEEECCCCCEE | 55.78 | 26051181 | |
| 119 | 2-Hydroxyisobutyrylation | IREVILCKDQDGKIG CCEEEEEECCCCCEE | 55.78 | - | |
| 124 | Acetylation | LCKDQDGKIGLRLKS EEECCCCCEEEEEEE | 41.72 | 25953088 | |
| 124 | Malonylation | LCKDQDGKIGLRLKS EEECCCCCEEEEEEE | 41.72 | 26320211 | |
| 124 | Ubiquitination | LCKDQDGKIGLRLKS EEECCCCCEEEEEEE | 41.72 | - | |
| 131 | Phosphorylation | KIGLRLKSIDNGIFV CEEEEEEEECCCEEE | 39.50 | 25850435 | |
| 145 | Phosphorylation | VQLVQANSPASLVGL EEEEECCCCHHHEEC | 25.51 | 25850435 | |
| 148 | Phosphorylation | VQANSPASLVGLRFG EECCCCHHHEECEEC | 27.29 | 25850435 | |
| 170 | Phosphorylation | GENCAGWSSDKAHKV CCCCCCCCCHHHHHH | 27.95 | 27251275 | |
| 171 | Phosphorylation | ENCAGWSSDKAHKVL CCCCCCCCHHHHHHH | 36.30 | 27251275 | |
| 173 | 2-Hydroxyisobutyrylation | CAGWSSDKAHKVLKQ CCCCCCHHHHHHHHH | 55.10 | - | |
| 173 | Acetylation | CAGWSSDKAHKVLKQ CCCCCCHHHHHHHHH | 55.10 | 26051181 | |
| 173 | Ubiquitination | CAGWSSDKAHKVLKQ CCCCCCHHHHHHHHH | 55.10 | - | |
| 178 (in isoform 2) | Ubiquitination | - | 3.97 | - | |
| 179 (in isoform 3) | Ubiquitination | - | 42.44 | 21890473 | |
| 179 | 2-Hydroxyisobutyrylation | DKAHKVLKQAFGEKI HHHHHHHHHHHCCCE | 42.44 | - | |
| 179 | Ubiquitination | DKAHKVLKQAFGEKI HHHHHHHHHHHCCCE | 42.44 | - | |
| 184 (in isoform 2) | Ubiquitination | - | 34.53 | - | |
| 185 | Ubiquitination | LKQAFGEKITMTIRD HHHHHCCCEEEEECC | 43.80 | 21890473 | |
| 185 | Ubiquitination | LKQAFGEKITMTIRD HHHHHCCCEEEEECC | 43.80 | 21890473 | |
| 185 (in isoform 1) | Ubiquitination | - | 43.80 | 21890473 | |
| 187 | Phosphorylation | QAFGEKITMTIRDRP HHHCCCEEEEECCCC | 21.23 | 20068231 | |
| 189 | Phosphorylation | FGEKITMTIRDRPFE HCCCEEEEECCCCCE | 12.29 | 20068231 | |
| 200 | Phosphorylation | RPFERTITMHKDSTG CCCEEEEEEECCCCC | 16.77 | 20068231 | |
| 205 | Phosphorylation | TITMHKDSTGHVGFI EEEEECCCCCCEEEE | 40.88 | 20068231 | |
| 205 (in isoform 2) | Ubiquitination | - | 40.88 | 21890473 | |
| 206 | Phosphorylation | ITMHKDSTGHVGFIF EEEECCCCCCEEEEE | 41.25 | 20068231 | |
| 214 | Acetylation | GHVGFIFKNGKITSI CCEEEEEECCEEEEE | 61.03 | 25953088 | |
| 220 | Phosphorylation | FKNGKITSIVKDSSA EECCEEEEEECCCHH | 28.94 | 22210691 | |
| 222 (in isoform 2) | Ubiquitination | - | 5.89 | - | |
| 223 | Malonylation | GKITSIVKDSSAARN CEEEEEECCCHHHHC | 50.66 | 26320211 | |
| 223 | Ubiquitination | GKITSIVKDSSAARN CEEEEEECCCHHHHC | 50.66 | 2190698 | |
| 252 | Phosphorylation | NVIGLKDSQIADILS EEECCCHHHHHHHHH | 23.15 | 30576142 | |
| 260 | Phosphorylation | QIADILSTSGTVVTI HHHHHHHCCCCEEEE | 27.94 | 30576142 | |
| 266 | Phosphorylation | STSGTVVTITIMPAF HCCCCEEEEEEEHHH | 14.20 | 30576142 | |
| 285 | Phosphorylation | IIKRMAPSIMKSLMD HHHHHCHHHHHHHHH | 26.27 | 22210691 | |
| 289 | Phosphorylation | MAPSIMKSLMDHTIP HCHHHHHHHHHCCCC | 16.14 | 22210691 | |
| 294 | Phosphorylation | MKSLMDHTIPEV--- HHHHHHCCCCCC--- | 33.68 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 4 | Y | Phosphorylation | Kinase | SRC | P12931 | PSP |
| 6 | S | Phosphorylation | Kinase | ULK1 | O75385 | PSP |
| 46 | Y | Phosphorylation | Kinase | SRC | P12931 | PSP |
| 60 | S | Phosphorylation | Kinase | ULK1 | O75385 | PSP |
| 131 | S | Phosphorylation | Kinase | AURA | O14965 | PSP |
| 200 | T | Phosphorylation | Kinase | AURA | O14965 | PSP |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SDCB1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SDCB1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-6, AND MASSSPECTROMETRY. | |
| "Evaluation of the low-specificity protease elastase for large-scalephosphoproteome analysis."; Wang B., Malik R., Nigg E.A., Korner R.; Anal. Chem. 80:9526-9533(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60, AND MASSSPECTROMETRY. | |
| "Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer."; Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.; Cell 131:1190-1203(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-46 AND TYR-91, AND MASSSPECTROMETRY. | |
