MARE3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MARE3_HUMAN
• UniProt AC: Q9UPY8
• Protein Name: Microtubule-associated protein RP/EB family member 3
• Gene Name: MAPRE3
• Organism: Homo sapiens (Human).
• Sequence Length: 281
• Subcellular Localization: Cytoplasm, cytoskeleton . Associated with the microtubule network. Detected at the plus end of microtubules.
• Protein Description: Plus-end tracking protein (+TIP) that binds to the plus-end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes microtubule growth. May be involved in spindle function by stabilizing microtubules and anchoring them at centrosomes. Also acts as a regulator of minus-end microtubule organization: interacts with the complex formed by AKAP9 and PDE4DIP, leading to recruit CAMSAP2 to the Golgi apparatus, thereby tethering non-centrosomal minus-end microtubules to the Golgi, an important step for polarized cell movement. [PubMed: 28814570 Promotes elongation of CAMSAP2-decorated microtubule stretches on the minus-end of microtubules]
• Protein Sequence: MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAVNVYSTS ------CCCEEEECC	11.11	-
40	Phosphorylation	TKIEQLCSGAAYCQF HHHHHHHCHHHHHHH	39.81	-
60	Ubiquitination	PGCVHLRKVKFQAKL CCCEEEEECEEEEEC	57.02	23000965
62	Ubiquitination	CVHLRKVKFQAKLEH CEEEEECEEEEECCC	34.49	23000965
66	Ubiquitination	RKVKFQAKLEHEYIH EECEEEEECCCHHHH	43.56	23000965
83	Acetylation	KVLQAAFKKMGVDKI HHHHHHHHHCCCCEE	36.80	25953088
95	Ubiquitination	DKIIPVEKLVKGKFQ CEEEEHHHHHCCCCC	59.83	22817900
98	Ubiquitination	IPVEKLVKGKFQDNF EEHHHHHCCCCCCCH	67.81	22817900
100	Ubiquitination	VEKLVKGKFQDNFEF HHHHHCCCCCCCHHH	33.85	22817900
113	Ubiquitination	EFIQWFKKFFDANYD HHHHHHHHHHCCCCC	41.61	21890473
119	Phosphorylation	KKFFDANYDGKDYNP HHHHCCCCCCCCCCH	28.00	-
122	Ubiquitination	FDANYDGKDYNPLLA HCCCCCCCCCCHHHH	54.89	30230243
124	Phosphorylation	ANYDGKDYNPLLARQ CCCCCCCCCHHHHHC	23.36	27642862
146 (in isoform 2)	Phosphorylation	-	8.61	26846344
147 (in isoform 2)	Phosphorylation	-	49.69	26846344
148	Ubiquitination	PGDQIFNKSKKLIGT CCHHHCCCHHHCCCE	53.56	32015554
149 (in isoform 2)	Phosphorylation	-	35.81	28450419
149	Phosphorylation	GDQIFNKSKKLIGTA CHHHCCCHHHCCCEE	35.81	28857561
150	Ubiquitination	DQIFNKSKKLIGTAV HHHCCCHHHCCCEEC	53.89	30230243
155	Phosphorylation	KSKKLIGTAVPQRTS CHHHCCCEECCCCCC	19.93	23927012
161	Phosphorylation	GTAVPQRTSPTGPKN CEECCCCCCCCCCCC	33.54	25159151
162	Phosphorylation	TAVPQRTSPTGPKNM EECCCCCCCCCCCCC	23.74	23927012
164	Phosphorylation	VPQRTSPTGPKNMQT CCCCCCCCCCCCCCC	66.92	23927012
171	Phosphorylation	TGPKNMQTSGRLSNV CCCCCCCCCCCCCCC	23.52	29978859
172	Phosphorylation	GPKNMQTSGRLSNVA CCCCCCCCCCCCCCC	12.67	29496963
176	Phosphorylation	MQTSGRLSNVAPPCI CCCCCCCCCCCCCEE	28.09	21712546
214 (in isoform 2)	Ubiquitination	-	7.99	21890473
214	Ubiquitination	QQLVDLKLTVDGLEK HHHCCEEEEECCCHH	7.99	21890473
229	Ubiquitination	ERDFYFSKLRDIELI HHHHHHHHHHCHHHH	37.33	21890473
229 (in isoform 1)	Ubiquitination	-	37.33	21890473
229	Ubiquitination	ERDFYFSKLRDIELI HHHHHHHHHHCHHHH	37.33	22817900
249	Phosphorylation	SENSPVISGIIGILY CCCCCCHHHHHHHHH	24.95	22468782
256	Phosphorylation	SGIIGILYATEEGFA HHHHHHHHHHCCCCC	15.01	22468782
258	Phosphorylation	IIGILYATEEGFAPP HHHHHHHHCCCCCCC	22.48	22468782

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
176	S	Phosphorylation	Kinase	AURKA	O14965	GPS
176	S	Phosphorylation	Kinase	AURKB	Q96GD4	GPS
-	K	Ubiquitination	E3 ubiquitin ligase	SIAH1	Q8IUQ4	PMID:19696028

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MARE3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MARE3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SIAH1_HUMAN	SIAH1	physical	19696028
THIOM_HUMAN	TXN2	physical	25416956
TEBP_HUMAN	PTGES3	physical	26344197
RBTN2_HUMAN	LMO2	physical	21516116
PSA1_HUMAN	PSMA1	physical	21516116

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.