UniProt ID | IN80E_HUMAN | |
---|---|---|
UniProt AC | Q8NBZ0 | |
Protein Name | INO80 complex subunit E | |
Gene Name | INO80E | |
Organism | Homo sapiens (Human). | |
Sequence Length | 244 | |
Subcellular Localization | Nucleus . | |
Protein Description | Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.. | |
Protein Sequence | MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPLQASGVPSPYLSSLASSRYPPFPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDDLVIDIPE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | PADGEVDYKKKYRNL CCCCCCCHHHHHHHH | 29.86 | 21403953 | |
50 | 2-Hydroxyisobutyrylation | LLKVSRDKSFLLDRL HHHHHHCHHHHHHHH | 41.83 | - | |
51 | Phosphorylation | LKVSRDKSFLLDRLL HHHHHCHHHHHHHHH | 25.97 | 21712546 | |
67 | Phosphorylation | YENVDEDSSDSDATA CCCCCCCCCCCCCCC | 33.72 | - | |
88 | Phosphorylation | TEGTPKLSDTPAPKR CCCCCCCCCCCCCCC | 45.63 | 29396449 | |
90 | Phosphorylation | GTPKLSDTPAPKRKR CCCCCCCCCCCCCCC | 20.27 | 29255136 | |
98 | Phosphorylation | PAPKRKRSPPLGGAP CCCCCCCCCCCCCCC | 33.63 | 28464451 | |
106 | Phosphorylation | PPLGGAPSPSSLSLP CCCCCCCCCHHCCCC | 36.56 | 28464451 | |
108 | Phosphorylation | LGGAPSPSSLSLPPS CCCCCCCHHCCCCCC | 48.53 | 27174698 | |
109 | Phosphorylation | GGAPSPSSLSLPPST CCCCCCHHCCCCCCC | 25.92 | 27174698 | |
111 | Phosphorylation | APSPSSLSLPPSTGF CCCCHHCCCCCCCCC | 40.55 | 27174698 | |
115 | Phosphorylation | SSLSLPPSTGFPLQA HHCCCCCCCCCCCCC | 38.94 | 27174698 | |
116 | Phosphorylation | SLSLPPSTGFPLQAS HCCCCCCCCCCCCCC | 48.92 | 27174698 | |
123 | Phosphorylation | TGFPLQASGVPSPYL CCCCCCCCCCCCHHH | 27.62 | 30177828 | |
127 | Phosphorylation | LQASGVPSPYLSSLA CCCCCCCCHHHHHHH | 24.62 | 26055452 | |
129 | Phosphorylation | ASGVPSPYLSSLASS CCCCCCHHHHHHHHH | 24.45 | 24144214 | |
131 | Phosphorylation | GVPSPYLSSLASSRY CCCCHHHHHHHHHCC | 19.91 | 24144214 | |
132 | Phosphorylation | VPSPYLSSLASSRYP CCCHHHHHHHHHCCC | 25.92 | 24144214 | |
135 | Phosphorylation | PYLSSLASSRYPPFP HHHHHHHHHCCCCCC | 22.20 | 24144214 | |
136 | Phosphorylation | YLSSLASSRYPPFPS HHHHHHHHCCCCCCC | 30.17 | 24144214 | |
143 | Phosphorylation | SRYPPFPSDYLALQL HCCCCCCCCCEEECC | 38.99 | 25884760 | |
145 | Phosphorylation | YPPFPSDYLALQLPE CCCCCCCCEEECCCC | 9.75 | 24732914 | |
154 | Phosphorylation | ALQLPEPSPLRPKRE EECCCCCCCCCCCCC | 34.60 | 25159151 | |
159 | Sumoylation | EPSPLRPKREKRPRL CCCCCCCCCCCCCCC | 67.75 | 28112733 | |
171 | Sumoylation | PRLPRKLKMAVGPPD CCCCCHHHCCCCCCC | 28.05 | 28112733 | |
192 | Phosphorylation | LTFPGRGSGAGVGTT CCCCCCCCCCCCCCC | 24.90 | 28674419 | |
199 | Phosphorylation | SGAGVGTTLTPLPPP CCCCCCCCCCCCCCC | 23.78 | 30576142 | |
201 | Phosphorylation | AGVGTTLTPLPPPKM CCCCCCCCCCCCCCC | 22.23 | 21815630 | |
212 | Phosphorylation | PPKMPPPTILSTVPR CCCCCCCCEECCCCH | 40.08 | 28555341 | |
215 | Phosphorylation | MPPPTILSTVPRQMF CCCCCEECCCCHHHH | 24.41 | 28555341 | |
223 | Phosphorylation | TVPRQMFSDAGSGDD CCCHHHHCCCCCCCC | 22.62 | 28102081 | |
227 | Phosphorylation | QMFSDAGSGDDALDG HHHCCCCCCCCCCCC | 40.55 | 20363803 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
154 | S | Phosphorylation | Kinase | CDK2 | P24941 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IN80E_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IN80E_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...