UniProt ID | HEN1_HUMAN | |
---|---|---|
UniProt AC | Q02575 | |
Protein Name | Helix-loop-helix protein 1 | |
Gene Name | NHLH1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 133 | |
Subcellular Localization | Nucleus . | |
Protein Description | May serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.. | |
Protein Sequence | MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
73 | Phosphorylation | RRRRRRATAKYRTAH HHHHHHHHHHHHHHH | 23.13 | - | |
76 | Phosphorylation | RRRATAKYRTAHATR HHHHHHHHHHHHHCH | 15.67 | - | |
78 | Phosphorylation | RATAKYRTAHATRER HHHHHHHHHHHCHHH | 21.50 | - | |
104 | Phosphorylation | ELRKLLPTLPPDKKL HHHHHHCCCCCCCCC | 52.44 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HEN1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HEN1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HEN1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RBTN2_HUMAN | LMO2 | physical | 12878195 | |
TFE2_HUMAN | TCF3 | physical | 12878195 | |
LMO3_XENLA | xlmo1 | physical | 10603358 | |
PSME2_HUMAN | PSME2 | physical | 21988832 | |
PIM1_HUMAN | PIM1 | physical | 25416956 | |
CENPP_HUMAN | CENPP | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...