| UniProt ID | UCHL5_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y5K5 | |
| Protein Name | Ubiquitin carboxyl-terminal hydrolase isozyme L5 | |
| Gene Name | UCHL5 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 329 | |
| Subcellular Localization | Cytoplasm . Nucleus . Associates with the proteasome 19S subunit in the cytoplasm. Associates with the INO80 complex in the nucleus. | |
| Protein Description | Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1.. | |
| Protein Sequence | MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 19 | Phosphorylation | ESDPGVFTELIKGFG CCCCCHHHHHHHCCC | 27.72 | 20068231 | |
| 30 | Ubiquitination | KGFGCRGAQVEEIWS HCCCCCCCCHHHHHH | 7.29 | 27667366 | |
| 34 | Ubiquitination | CRGAQVEEIWSLEPE CCCCCHHHHHHCCCC | 51.40 | 27667366 | |
| 36 | Ubiquitination | GAQVEEIWSLEPENF CCCHHHHHHCCCCHH | 10.51 | 23503661 | |
| 37 | Phosphorylation | AQVEEIWSLEPENFE CCHHHHHHCCCCHHH | 28.63 | 28348404 | |
| 38 | Ubiquitination | QVEEIWSLEPENFEK CHHHHHHCCCCHHHH | 8.38 | 30230243 | |
| 45 | Ubiquitination | LEPENFEKLKPVHGL CCCCHHHHCCCCEEE | 58.64 | 23503661 | |
| 45 (in isoform 3) | Ubiquitination | - | 58.64 | - | |
| 47 | Succinylation | PENFEKLKPVHGLIF CCHHHHCCCCEEEEE | 56.94 | - | |
| 47 | Succinylation | PENFEKLKPVHGLIF CCHHHHCCCCEEEEE | 56.94 | - | |
| 47 | Ubiquitination | PENFEKLKPVHGLIF CCHHHHCCCCEEEEE | 56.94 | 30230243 | |
| 47 (in isoform 4) | Ubiquitination | - | 56.94 | - | |
| 57 | Ubiquitination | HGLIFLFKWQPGEEP EEEEEEEEECCCCCC | 47.25 | - | |
| 65 | Ubiquitination | WQPGEEPAGSVVQDS ECCCCCCCCCCCCCC | 26.60 | 23503661 | |
| 67 | Ubiquitination | PGEEPAGSVVQDSRL CCCCCCCCCCCCCCH | 22.63 | 30230243 | |
| 82 | Ubiquitination | DTIFFAKQVINNACA HHHHHHHHHHHHHHH | 37.58 | 21963094 | |
| 86 | Ubiquitination | FAKQVINNACATQAI HHHHHHHHHHHHHHH | 25.85 | 21963094 | |
| 103 | Ubiquitination | VLLNCTHQDVHLGET HHHCCCCCCCCCCCH | 35.95 | 21963094 | |
| 104 | Ubiquitination | LLNCTHQDVHLGETL HHCCCCCCCCCCCHH | 23.38 | 23503661 | |
| 110 | Ubiquitination | QDVHLGETLSEFKEF CCCCCCCHHHHHHHH | 33.51 | 21963094 | |
| 112 | Ubiquitination | VHLGETLSEFKEFSQ CCCCCHHHHHHHHHH | 48.70 | 23503661 | |
| 114 | Ubiquitination | LGETLSEFKEFSQSF CCCHHHHHHHHHHHH | 9.14 | 23503661 | |
| 117 | Ubiquitination | TLSEFKEFSQSFDAA HHHHHHHHHHHHHHH | 9.20 | 27667366 | |
| 120 | Phosphorylation | EFKEFSQSFDAAMKG HHHHHHHHHHHHHHH | 24.72 | 25159151 | |
| 121 | Ubiquitination | FKEFSQSFDAAMKGL HHHHHHHHHHHHHHH | 6.01 | 21890473 | |
| 126 | Ubiquitination | QSFDAAMKGLALSNS HHHHHHHHHHHHCCH | 46.15 | 21906983 | |
| 126 (in isoform 1) | Ubiquitination | - | 46.15 | 21890473 | |
| 126 (in isoform 2) | Ubiquitination | - | 46.15 | 21890473 | |
| 126 (in isoform 3) | Ubiquitination | - | 46.15 | 21890473 | |
| 126 (in isoform 4) | Ubiquitination | - | 46.15 | 21890473 | |
| 131 | Ubiquitination | AMKGLALSNSDVIRQ HHHHHHHCCHHHHHH | 28.78 | 23503661 | |
| 137 | Ubiquitination | LSNSDVIRQVHNSFA HCCHHHHHHHHHHHH | 32.11 | 21963094 | |
| 142 | Phosphorylation | VIRQVHNSFARQQMF HHHHHHHHHHHHHHE | 12.85 | - | |
| 145 | Ubiquitination | QVHNSFARQQMFEFD HHHHHHHHHHHEEEC | 25.83 | 27667366 | |
| 146 | Ubiquitination | VHNSFARQQMFEFDT HHHHHHHHHHEEECC | 35.34 | 32015554 | |
| 148 | Sulfoxidation | NSFARQQMFEFDTKT HHHHHHHHEEECCCC | 2.35 | 21406390 | |
| 149 | Ubiquitination | SFARQQMFEFDTKTS HHHHHHHEEECCCCC | 8.01 | 27667366 | |
| 152 | Ubiquitination | RQQMFEFDTKTSAKE HHHHEEECCCCCCCH | 39.84 | 21963094 | |
| 153 | Ubiquitination | QQMFEFDTKTSAKEE HHHEEECCCCCCCHH | 41.36 | 21963094 | |
| 154 | Acetylation | QMFEFDTKTSAKEED HHEEECCCCCCCHHC | 42.18 | 25953088 | |
| 154 | Sumoylation | QMFEFDTKTSAKEED HHEEECCCCCCCHHC | 42.18 | - | |
| 154 | Ubiquitination | QMFEFDTKTSAKEED HHEEECCCCCCCHHC | 42.18 | 27667366 | |
| 154 (in isoform 1) | Ubiquitination | - | 42.18 | 21890473 | |
| 154 (in isoform 2) | Ubiquitination | - | 42.18 | 21890473 | |
| 154 (in isoform 3) | Ubiquitination | - | 42.18 | 21890473 | |
| 154 (in isoform 4) | Ubiquitination | - | 42.18 | 21890473 | |
| 155 | Ubiquitination | MFEFDTKTSAKEEDA HEEECCCCCCCHHCC | 35.69 | 23503661 | |
| 157 | Ubiquitination | EFDTKTSAKEEDAFH EECCCCCCCHHCCEE | 28.63 | 27667366 | |
| 158 | Acetylation | FDTKTSAKEEDAFHF ECCCCCCCHHCCEEE | 62.49 | 19608861 | |
| 158 | Ubiquitination | FDTKTSAKEEDAFHF ECCCCCCCHHCCEEE | 62.49 | 27667366 | |
| 158 (in isoform 1) | Ubiquitination | - | 62.49 | 21890473 | |
| 158 (in isoform 2) | Ubiquitination | - | 62.49 | 21890473 | |
| 158 (in isoform 3) | Ubiquitination | - | 62.49 | 21890473 | |
| 158 (in isoform 4) | Ubiquitination | - | 62.49 | 21890473 | |
| 164 | Ubiquitination | AKEEDAFHFVSYVPV CCHHCCEEEEEEEEE | 24.74 | 21963094 | |
| 165 | Ubiquitination | KEEDAFHFVSYVPVN CHHCCEEEEEEEEEC | 2.93 | 21963094 | |
| 169 | Ubiquitination | AFHFVSYVPVNGRLY CEEEEEEEEECCEEE | 3.12 | 21963094 | |
| 173 | Ubiquitination | VSYVPVNGRLYELDG EEEEEECCEEEEECC | 22.62 | 21963094 | |
| 174 | Ubiquitination | SYVPVNGRLYELDGL EEEEECCEEEEECCC | 28.97 | 27667366 | |
| 176 | Ubiquitination | VPVNGRLYELDGLRE EEECCEEEEECCCCC | 17.06 | 33845483 | |
| 177 | Ubiquitination | PVNGRLYELDGLREG EECCEEEEECCCCCC | 45.00 | 33845483 | |
| 178 | Ubiquitination | VNGRLYELDGLREGP ECCEEEEECCCCCCC | 3.90 | 27667366 | |
| 179 | Ubiquitination | NGRLYELDGLREGPI CCEEEEECCCCCCCC | 41.98 | 21963094 | |
| 180 | Ubiquitination | GRLYELDGLREGPID CEEEEECCCCCCCCC | 38.98 | 21963094 | |
| 181 | Ubiquitination | RLYELDGLREGPIDL EEEEECCCCCCCCCC | 4.50 | 23503661 | |
| 182 | Ubiquitination | LYELDGLREGPIDLG EEEECCCCCCCCCCC | 52.97 | 23503661 | |
| 184 | Ubiquitination | ELDGLREGPIDLGAC EECCCCCCCCCCCCC | 20.30 | 24816145 | |
| 185 | Ubiquitination | LDGLREGPIDLGACN ECCCCCCCCCCCCCC | 16.50 | 24816145 | |
| 190 | Ubiquitination | EGPIDLGACNQDDWI CCCCCCCCCCHHHHH | 9.08 | 27667366 | |
| 191 | Glutathionylation | GPIDLGACNQDDWIS CCCCCCCCCHHHHHH | 4.45 | 22555962 | |
| 191 | Ubiquitination | GPIDLGACNQDDWIS CCCCCCCCCHHHHHH | 4.45 | 27667366 | |
| 192 | Ubiquitination | PIDLGACNQDDWISA CCCCCCCCHHHHHHH | 48.02 | 21963094 | |
| 193 | Ubiquitination | IDLGACNQDDWISAV CCCCCCCHHHHHHHH | 50.34 | 22817900 | |
| 194 | Ubiquitination | DLGACNQDDWISAVR CCCCCCHHHHHHHHH | 38.94 | 22817900 | |
| 195 | Ubiquitination | LGACNQDDWISAVRP CCCCCHHHHHHHHHH | 34.54 | 22817900 | |
| 197 | Ubiquitination | ACNQDDWISAVRPVI CCCHHHHHHHHHHHH | 2.14 | 21963094 | |
| 201 | Ubiquitination | DDWISAVRPVIEKRI HHHHHHHHHHHHHHH | 21.34 | 21963094 | |
| 206 | Acetylation | AVRPVIEKRIQKYSE HHHHHHHHHHHHHCC | 43.61 | 26051181 | |
| 206 | Ubiquitination | AVRPVIEKRIQKYSE HHHHHHHHHHHHHCC | 43.61 | 21963094 | |
| 206 (in isoform 3) | Ubiquitination | - | 43.61 | - | |
| 206 (in isoform 4) | Ubiquitination | - | 43.61 | - | |
| 210 | Acetylation | VIEKRIQKYSEGEIR HHHHHHHHHCCCCEE | 48.66 | 25953088 | |
| 210 | Ubiquitination | VIEKRIQKYSEGEIR HHHHHHHHHCCCCEE | 48.66 | 21906983 | |
| 210 (in isoform 1) | Ubiquitination | - | 48.66 | 21890473 | |
| 210 (in isoform 2) | Ubiquitination | - | 48.66 | 21890473 | |
| 210 (in isoform 3) | Ubiquitination | - | 48.66 | 21890473 | |
| 210 (in isoform 4) | Ubiquitination | - | 48.66 | 21890473 | |
| 217 | Ubiquitination | KYSEGEIRFNLMAIV HHCCCCEEEEEEEHH | 15.31 | 27667366 | |
| 218 | Ubiquitination | YSEGEIRFNLMAIVS HCCCCEEEEEEEHHH | 11.48 | 27667366 | |
| 219 | Ubiquitination | SEGEIRFNLMAIVSD CCCCEEEEEEEHHHC | 21.03 | 22817900 | |
| 220 | Ubiquitination | EGEIRFNLMAIVSDR CCCEEEEEEEHHHCH | 1.95 | 22817900 | |
| 221 | Ubiquitination | GEIRFNLMAIVSDRK CCEEEEEEEHHHCHH | 2.22 | 27667366 | |
| 222 | Ubiquitination | EIRFNLMAIVSDRKM CEEEEEEEHHHCHHH | 11.38 | 22817900 | |
| 224 | Ubiquitination | RFNLMAIVSDRKMIY EEEEEEHHHCHHHHH | 3.37 | 21963094 | |
| 225 | Ubiquitination | FNLMAIVSDRKMIYE EEEEEHHHCHHHHHH | 26.11 | 27667366 | |
| 226 | Ubiquitination | NLMAIVSDRKMIYEQ EEEEHHHCHHHHHHH | 43.24 | 21963094 | |
| 227 | Methylation | LMAIVSDRKMIYEQK EEEHHHCHHHHHHHH | 23.96 | 24391063 | |
| 228 | Acetylation | MAIVSDRKMIYEQKI EEHHHCHHHHHHHHH | 34.34 | 24885497 | |
| 228 | Ubiquitination | MAIVSDRKMIYEQKI EEHHHCHHHHHHHHH | 34.34 | 23503661 | |
| 228 (in isoform 4) | Ubiquitination | - | 34.34 | - | |
| 230 | Ubiquitination | IVSDRKMIYEQKIAE HHHCHHHHHHHHHHH | 3.72 | 21963094 | |
| 234 | Ubiquitination | RKMIYEQKIAELQRQ HHHHHHHHHHHHHHH | 31.76 | 21963094 | |
| 234 (in isoform 1) | Ubiquitination | - | 31.76 | 21890473 | |
| 234 (in isoform 2) | Ubiquitination | - | 31.76 | 21890473 | |
| 234 (in isoform 3) | Ubiquitination | - | 31.76 | 21890473 | |
| 234 (in isoform 4) | Ubiquitination | - | 31.76 | 21890473 | |
| 239 | Ubiquitination | EQKIAELQRQLAEEE HHHHHHHHHHHHHCC | 23.68 | 21963094 | |
| 240 | Ubiquitination | QKIAELQRQLAEEEP HHHHHHHHHHHHCCC | 46.21 | 21963094 | |
| 241 | Ubiquitination | KIAELQRQLAEEEPM HHHHHHHHHHHCCCC | 31.87 | 23503661 | |
| 242 | Ubiquitination | IAELQRQLAEEEPMD HHHHHHHHHHCCCCC | 7.64 | 23503661 | |
| 244 | Ubiquitination | ELQRQLAEEEPMDTD HHHHHHHHCCCCCCH | 72.05 | 24816145 | |
| 245 | Ubiquitination | LQRQLAEEEPMDTDQ HHHHHHHCCCCCCHH | 62.89 | 24816145 | |
| 246 | Ubiquitination | QRQLAEEEPMDTDQG HHHHHHCCCCCCHHH | 37.11 | 23503661 | |
| 247 | Ubiquitination | RQLAEEEPMDTDQGN HHHHHCCCCCCHHHH | 29.27 | 21963094 | |
| 248 | Ubiquitination | QLAEEEPMDTDQGNS HHHHCCCCCCHHHHH | 11.09 | 23503661 | |
| 249 (in isoform 2) | Phosphorylation | - | 58.82 | 28111955 | |
| 249 (in isoform 3) | Phosphorylation | - | 58.82 | 28111955 | |
| 249 (in isoform 4) | Phosphorylation | - | 58.82 | 28111955 | |
| 250 | Phosphorylation | AEEEPMDTDQGNSML HHCCCCCCHHHHHHH | 24.78 | 28857561 | |
| 251 | Ubiquitination | EEEPMDTDQGNSMLS HCCCCCCHHHHHHHH | 50.56 | 21963094 | |
| 252 | Ubiquitination | EEPMDTDQGNSMLSA CCCCCCHHHHHHHHH | 55.87 | 21963094 | |
| 254 | Phosphorylation | PMDTDQGNSMLSAIQ CCCCHHHHHHHHHHH | 20.72 | 27251275 | |
| 254 | Ubiquitination | PMDTDQGNSMLSAIQ CCCCHHHHHHHHHHH | 20.72 | 21963094 | |
| 254 (in isoform 2) | Phosphorylation | - | 20.72 | 28111955 | |
| 254 (in isoform 3) | Phosphorylation | - | 20.72 | 28111955 | |
| 254 (in isoform 4) | Phosphorylation | - | 20.72 | 28111955 | |
| 255 | Phosphorylation | MDTDQGNSMLSAIQS CCCHHHHHHHHHHHH | 28.11 | 26657352 | |
| 257 (in isoform 2) | Phosphorylation | - | 2.91 | 28111955 | |
| 257 (in isoform 3) | Phosphorylation | - | 2.91 | 28111955 | |
| 257 (in isoform 4) | Phosphorylation | - | 2.91 | 28111955 | |
| 261 | Ubiquitination | NSMLSAIQSEVAKNQ HHHHHHHHHHHHHHC | 33.00 | 33845483 | |
| 261 (in isoform 2) | Phosphorylation | - | 33.00 | 28111955 | |
| 261 (in isoform 3) | Phosphorylation | - | 33.00 | 28111955 | |
| 261 (in isoform 4) | Phosphorylation | - | 33.00 | 28111955 | |
| 265 | Ubiquitination | SAIQSEVAKNQMLIE HHHHHHHHHHCCCCH | 10.88 | 29967540 | |
| 266 | Ubiquitination | AIQSEVAKNQMLIEE HHHHHHHHHCCCCHH | 53.54 | 29967540 | |
| 267 | Ubiquitination | IQSEVAKNQMLIEEE HHHHHHHHCCCCHHH | 23.82 | 21963094 | |
| 268 | Ubiquitination | QSEVAKNQMLIEEEV HHHHHHHCCCCHHHH | 27.61 | 21963094 | |
| 269 | Sulfoxidation | SEVAKNQMLIEEEVQ HHHHHHCCCCHHHHH | 5.94 | 21406390 | |
| 269 | Ubiquitination | SEVAKNQMLIEEEVQ HHHHHHCCCCHHHHH | 5.94 | 23503661 | |
| 270 | Ubiquitination | EVAKNQMLIEEEVQK HHHHHCCCCHHHHHH | 3.00 | 23503661 | |
| 272 | Ubiquitination | AKNQMLIEEEVQKLK HHHCCCCHHHHHHHH | 44.11 | 27667366 | |
| 273 | Ubiquitination | KNQMLIEEEVQKLKR HHCCCCHHHHHHHHC | 57.38 | 27667366 | |
| 275 | Ubiquitination | QMLIEEEVQKLKRYK CCCCHHHHHHHHCCC | 7.42 | 23503661 | |
| 276 | Ubiquitination | MLIEEEVQKLKRYKI CCCHHHHHHHHCCCH | 48.95 | 21963094 | |
| 276 (in isoform 2) | Ubiquitination | - | 48.95 | 21890473 | |
| 276 (in isoform 3) | Ubiquitination | - | 48.95 | 21890473 | |
| 276 (in isoform 4) | Ubiquitination | - | 48.95 | 21890473 | |
| 277 | Ubiquitination | LIEEEVQKLKRYKIE CCHHHHHHHHCCCHH | 62.24 | 21906983 | |
| 277 (in isoform 1) | Ubiquitination | - | 62.24 | 21890473 | |
| 278 | Ubiquitination | IEEEVQKLKRYKIEN CHHHHHHHHCCCHHH | 1.82 | 27667366 | |
| 278 (in isoform 4) | Ubiquitination | - | 1.82 | - | |
| 279 | Ubiquitination | EEEVQKLKRYKIENI HHHHHHHHCCCHHHH | 61.80 | 21963094 | |
| 280 | Ubiquitination | EEVQKLKRYKIENIR HHHHHHHCCCHHHHH | 48.70 | 21963094 | |
| 281 | Ubiquitination | EVQKLKRYKIENIRR HHHHHHCCCHHHHHH | 18.09 | 27667366 | |
| 281 (in isoform 4) | Ubiquitination | - | 18.09 | - | |
| 282 | Acetylation | VQKLKRYKIENIRRK HHHHHCCCHHHHHHH | 47.80 | 26051181 | |
| 282 | Ubiquitination | VQKLKRYKIENIRRK HHHHHCCCHHHHHHH | 47.80 | 27667366 | |
| 288 | Ubiquitination | YKIENIRRKHNYLPF CCHHHHHHHCCHHHH | 40.57 | 21963094 | |
| 288 (in isoform 4) | Ubiquitination | - | 40.57 | - | |
| 289 | Succinylation | KIENIRRKHNYLPFI CHHHHHHHCCHHHHH | 26.76 | - | |
| 289 | Succinylation | KIENIRRKHNYLPFI CHHHHHHHCCHHHHH | 26.76 | - | |
| 289 | Ubiquitination | KIENIRRKHNYLPFI CHHHHHHHCCHHHHH | 26.76 | 21963094 | |
| 291 | Ubiquitination | ENIRRKHNYLPFIME HHHHHHCCHHHHHHH | 42.97 | 33845483 | |
| 292 | Ubiquitination | NIRRKHNYLPFIMEL HHHHHCCHHHHHHHH | 18.57 | 33845483 | |
| 294 | Ubiquitination | RRKHNYLPFIMELLK HHHCCHHHHHHHHHH | 13.32 | 21963094 | |
| 295 | Ubiquitination | RKHNYLPFIMELLKT HHCCHHHHHHHHHHH | 8.40 | 21963094 | |
| 296 | Ubiquitination | KHNYLPFIMELLKTL HCCHHHHHHHHHHHH | 1.66 | 21963094 | |
| 297 | Sulfoxidation | HNYLPFIMELLKTLA CCHHHHHHHHHHHHH | 2.80 | 30846556 | |
| 297 | Ubiquitination | HNYLPFIMELLKTLA CCHHHHHHHHHHHHH | 2.80 | 23503661 | |
| 298 | Ubiquitination | NYLPFIMELLKTLAE CHHHHHHHHHHHHHH | 46.24 | 23503661 | |
| 300 | Ubiquitination | LPFIMELLKTLAEHQ HHHHHHHHHHHHHHH | 2.25 | 33845483 | |
| 301 | Ubiquitination | PFIMELLKTLAEHQQ HHHHHHHHHHHHHHC | 54.86 | 27667366 | |
| 303 | Ubiquitination | IMELLKTLAEHQQLI HHHHHHHHHHHHCHH | 5.14 | 33845483 | |
| 304 | Ubiquitination | MELLKTLAEHQQLIP HHHHHHHHHHHCHHH | 19.91 | 33845483 | |
| 305 | Ubiquitination | ELLKTLAEHQQLIPL HHHHHHHHHHCHHHH | 45.39 | 27667366 | |
| 306 | Ubiquitination | LLKTLAEHQQLIPLV HHHHHHHHHCHHHHH | 18.32 | 27667366 | |
| 307 | Ubiquitination | LKTLAEHQQLIPLVE HHHHHHHHCHHHHHH | 31.14 | 21963094 | |
| 308 | Ubiquitination | KTLAEHQQLIPLVEK HHHHHHHCHHHHHHH | 43.18 | 21963094 | |
| 309 | Ubiquitination | TLAEHQQLIPLVEKA HHHHHHCHHHHHHHH | 3.33 | 33845483 | |
| 310 | Ubiquitination | LAEHQQLIPLVEKAK HHHHHCHHHHHHHHH | 1.84 | 22817900 | |
| 314 | Ubiquitination | QQLIPLVEKAKEKQN HCHHHHHHHHHHHHH | 55.79 | 27667366 | |
| 314 (in isoform 3) | Ubiquitination | - | 55.79 | 21890473 | |
| 314 (in isoform 4) | Ubiquitination | - | 55.79 | - | |
| 315 | Ubiquitination | QLIPLVEKAKEKQNA CHHHHHHHHHHHHHH | 58.23 | 27667366 | |
| 315 (in isoform 1) | Ubiquitination | - | 58.23 | 21890473 | |
| 316 | Ubiquitination | LIPLVEKAKEKQNAK HHHHHHHHHHHHHHH | 16.25 | 33845483 | |
| 317 | Ubiquitination | IPLVEKAKEKQNAKK HHHHHHHHHHHHHHH | 76.22 | 22817900 | |
| 317 (in isoform 4) | Ubiquitination | - | 76.22 | - | |
| 318 | Ubiquitination | PLVEKAKEKQNAKKA HHHHHHHHHHHHHHH | 65.81 | 22817900 | |
| 319 | Ubiquitination | LVEKAKEKQNAKKAQ HHHHHHHHHHHHHHH | 48.41 | 22817900 | |
| 320 | Ubiquitination | VEKAKEKQNAKKAQE HHHHHHHHHHHHHHH | 57.09 | 33845483 | |
| 321 | Ubiquitination | EKAKEKQNAKKAQET HHHHHHHHHHHHHHC | 65.87 | 29967540 | |
| 321 (in isoform 4) | Ubiquitination | - | 65.87 | - | |
| 322 | Ubiquitination | KAKEKQNAKKAQETK HHHHHHHHHHHHHCC | 16.54 | 23503661 | |
| 323 | Ubiquitination | AKEKQNAKKAQETK- HHHHHHHHHHHHCC- | 57.08 | 21963094 | |
| 324 | Ubiquitination | KEKQNAKKAQETK-- HHHHHHHHHHHCC-- | 53.55 | 21963094 | |
| 325 | Ubiquitination | EKQNAKKAQETK--- HHHHHHHHHHCC--- | 16.25 | 23503661 | |
| 326 | Ubiquitination | KQNAKKAQETK---- HHHHHHHHHCC---- | 68.70 | 23503661 | |
| 327 | Ubiquitination | QNAKKAQETK----- HHHHHHHHCC----- | 64.52 | 33845483 | |
| 328 | Ubiquitination | NAKKAQETK------ HHHHHHHCC------ | 29.94 | 27667366 | |
| 329 | Ubiquitination | AKKAQETK------- HHHHHHCC------- | 58.55 | 24816145 | |
| 333 | Ubiquitination | QETK----------- HHCC----------- | 27667366 | ||
| 334 | Ubiquitination | ETK------------ HCC------------ | 27667366 | ||
| 335 | Ubiquitination | TK------------- CC------------- | 21963094 | ||
| 336 | Ubiquitination | K-------------- C-------------- | 21963094 | ||
| 337 | Ubiquitination | --------------- --------------- | 22817900 | ||
| 338 | Ubiquitination | ---------------- ---------------- | 22817900 | ||
| 341 | Ubiquitination | ------------------- ------------------- | 33845483 | ||
| 342 | Ubiquitination | -------------------- -------------------- | 33845483 | ||
| 343 | Ubiquitination | --------------------- --------------------- | 21963094 | ||
| 344 | Ubiquitination | ---------------------- ---------------------- | 21963094 | ||
| 345 | Ubiquitination | ----------------------- ----------------------- | 23503661 | ||
| 346 | Ubiquitination | ------------------------ ------------------------ | 23503661 | ||
| 347 | Ubiquitination | ------------------------- ------------------------- | 33845483 | ||
| 348 | Ubiquitination | -------------------------- -------------------------- | 24816145 | ||
| 349 | Ubiquitination | --------------------------- --------------------------- | 24816145 | ||
| 355 | Ubiquitination | --------------------------------- --------------------------------- | 21963094 | ||
| 356 | Ubiquitination | ---------------------------------- ---------------------------------- | 21963094 | ||
| 361 | Ubiquitination | --------------------------------------- --------------------------------------- | 27667366 | ||
| 362 | Ubiquitination | ---------------------------------------- ---------------------------------------- | 27667366 | ||
| 363 | Ubiquitination | ----------------------------------------- ----------------------------------------- | 22817900 | ||
| 364 | Ubiquitination | ------------------------------------------ ------------------------------------------ | 22817900 | ||
| 365 | Ubiquitination | ------------------------------------------- ------------------------------------------- | 22817900 | ||
| 366 | Ubiquitination | -------------------------------------------- -------------------------------------------- | 22817900 | ||
| 370 | Ubiquitination | ------------------------------------------------ ------------------------------------------------ | 21963094 | ||
| 371 | Ubiquitination | ------------------------------------------------- ------------------------------------------------- | 21963094 | ||
| 372 | Ubiquitination | -------------------------------------------------- -------------------------------------------------- | 23503661 | ||
| 373 | Ubiquitination | --------------------------------------------------- --------------------------------------------------- | 23503661 | ||
| 375 | Ubiquitination | ----------------------------------------------------- ----------------------------------------------------- | 24816145 | ||
| 376 | Ubiquitination | ------------------------------------------------------ ------------------------------------------------------ | 24816145 | ||
| 382 | Ubiquitination | ------------------------------------------------------------ ------------------------------------------------------------ | 21963094 | ||
| 383 | Ubiquitination | ------------------------------------------------------------- ------------------------------------------------------------- | 21963094 | ||
| 408 | Ubiquitination | -------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------- | 27667366 | ||
| 409 | Ubiquitination | --------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------- | 27667366 | ||
| 410 | Ubiquitination | ---------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------- | 22817900 | ||
| 411 | Ubiquitination | ----------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------- | 22817900 | ||
| 412 | Ubiquitination | ------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------ | 22817900 | ||
| 413 | Ubiquitination | ------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------- | 22817900 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UCHL5_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UCHL5_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-158, AND MASS SPECTROMETRY. | |
