UniProt ID | K2C80_HUMAN | |
---|---|---|
UniProt AC | Q6KB66 | |
Protein Name | Keratin, type II cytoskeletal 80 | |
Gene Name | KRT80 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 452 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MACRSCVVGFSSLSSCEVTPVGSPRPGTSGWDSCRAPGPGFSSRSLTGCWSAGTISKVTVNPGLLVPLDVKLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQRNQLLETRWSFLQGQDSAIFDLGHLYEEYQGRLQEELRKVSQERGQLEANLLQVLEKVEEFRIRYEDEISKRTDMEFTFVQLKKDLDAECLHRTELETKLKSLESFVELMKTIYEQELKDLAAQVKDVSVTVGMDSRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEEQAARSAEYGSSLQSSRSEIADLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEAALQQAKQDMARQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAASRSGLSKAPSRKKKGSKGPVIKITEMSEKYFSQESEVSE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MACRSCVVGFSS ---CCCCCCEEECCC | 15.90 | 23312004 | |
11 | Phosphorylation | RSCVVGFSSLSSCEV CCCEEECCCCCCCEE | 25.17 | 30576142 | |
12 | Phosphorylation | SCVVGFSSLSSCEVT CCEEECCCCCCCEEE | 29.97 | 29083192 | |
14 | Phosphorylation | VVGFSSLSSCEVTPV EEECCCCCCCEEECC | 34.58 | 30576142 | |
15 | Phosphorylation | VGFSSLSSCEVTPVG EECCCCCCCEEECCC | 21.42 | 29083192 | |
19 | Phosphorylation | SLSSCEVTPVGSPRP CCCCCEEECCCCCCC | 7.03 | 25394399 | |
23 | Phosphorylation | CEVTPVGSPRPGTSG CEEECCCCCCCCCCC | 20.26 | 21712546 | |
28 | Phosphorylation | VGSPRPGTSGWDSCR CCCCCCCCCCCCCCC | 27.09 | 23312004 | |
29 | Phosphorylation | GSPRPGTSGWDSCRA CCCCCCCCCCCCCCC | 43.75 | 21712546 | |
33 | Phosphorylation | PGTSGWDSCRAPGPG CCCCCCCCCCCCCCC | 10.05 | 23312004 | |
45 | Phosphorylation | GPGFSSRSLTGCWSA CCCCCCCCCCCCCCC | 32.03 | 30183078 | |
47 | Phosphorylation | GFSSRSLTGCWSAGT CCCCCCCCCCCCCCE | 31.38 | 21815630 | |
51 | Phosphorylation | RSLTGCWSAGTISKV CCCCCCCCCCEEEEE | 22.39 | 22199227 | |
54 | Phosphorylation | TGCWSAGTISKVTVN CCCCCCCEEEEEEEC | 23.07 | 22199227 | |
59 | Phosphorylation | AGTISKVTVNPGLLV CCEEEEEEECCCCEE | 20.50 | 20860994 | |
71 (in isoform 1) | Ubiquitination | - | 47.00 | 21906983 | |
71 | Ubiquitination | LLVPLDVKLDPAVQQ CEEEEECCCCHHHHH | 47.00 | 21906983 | |
71 (in isoform 2) | Ubiquitination | - | 47.00 | 21906983 | |
71 | Sumoylation | LLVPLDVKLDPAVQQ CEEEEECCCCHHHHH | 47.00 | - | |
71 | Sumoylation | LLVPLDVKLDPAVQQ CEEEEECCCCHHHHH | 47.00 | - | |
80 | Ubiquitination | DPAVQQLKNQEKEEM CHHHHHHHHHHHHHH | 52.85 | 29967540 | |
88 | Sumoylation | NQEKEEMKALNDKFA HHHHHHHHHHHHHHH | 53.66 | - | |
88 | Sumoylation | NQEKEEMKALNDKFA HHHHHHHHHHHHHHH | 53.66 | - | |
88 | Ubiquitination | NQEKEEMKALNDKFA HHHHHHHHHHHHHHH | 53.66 | 23503661 | |
93 | Sumoylation | EMKALNDKFASLIGK HHHHHHHHHHHHHHH | 41.58 | - | |
93 | Ubiquitination | EMKALNDKFASLIGK HHHHHHHHHHHHHHH | 41.58 | 21987572 | |
93 (in isoform 1) | Ubiquitination | - | 41.58 | 21906983 | |
93 (in isoform 2) | Ubiquitination | - | 41.58 | 21906983 | |
93 | Sumoylation | EMKALNDKFASLIGK HHHHHHHHHHHHHHH | 41.58 | - | |
96 | Phosphorylation | ALNDKFASLIGKVQA HHHHHHHHHHHHHHH | 24.53 | 28555341 | |
100 | Ubiquitination | KFASLIGKVQALEQR HHHHHHHHHHHHHHH | 24.95 | 21987572 | |
100 (in isoform 2) | Ubiquitination | - | 24.95 | - | |
171 | Phosphorylation | VEEFRIRYEDEISKR HHHHCHHCHHHHHHC | 25.92 | 24114839 | |
190 | Ubiquitination | FTFVQLKKDLDAECL EEEEEECCCCCHHHH | 72.60 | 29967540 | |
205 | Ubiquitination | HRTELETKLKSLESF HHHHHHHHHHHHHHH | 44.54 | 29967540 | |
225 | Ubiquitination | TIYEQELKDLAAQVK HHHHHHHHHHHHHCC | 50.36 | 29967540 | |
235 | Phosphorylation | AAQVKDVSVTVGMDS HHHCCCEEEEECCCC | 23.39 | 28674419 | |
242 | Phosphorylation | SVTVGMDSRCHIDLS EEEECCCCCCEEECC | 28.10 | 28674419 | |
256 | Ubiquitination | SGIVEEVKAQYDAVA CHHHHHHHHHHCHHH | 32.81 | 29967540 | |
259 | Phosphorylation | VEEVKAQYDAVAARS HHHHHHHHCHHHHHC | 15.66 | 28674419 | |
266 | Phosphorylation | YDAVAARSLEEAEAY HCHHHHHCHHHHHHH | 35.09 | 21815630 | |
273 | Phosphorylation | SLEEAEAYSRSQLEE CHHHHHHHCHHHHHH | 8.98 | 21406692 | |
274 | Phosphorylation | LEEAEAYSRSQLEEQ HHHHHHHCHHHHHHH | 32.29 | 21406692 | |
276 | Phosphorylation | EAEAYSRSQLEEQAA HHHHHCHHHHHHHHH | 32.93 | 28555341 | |
288 | Phosphorylation | QAARSAEYGSSLQSS HHHHHHHHHHHHHHC | 23.25 | 28674419 | |
315 | Phosphorylation | KLRSQILSVKSHCLK HHHHHHHHHHHHHHH | 29.18 | 24719451 | |
317 | Ubiquitination | RSQILSVKSHCLKLE HHHHHHHHHHHHHHH | 30.98 | 29967540 | |
322 | Ubiquitination | SVKSHCLKLEENIKT HHHHHHHHHHHHHHH | 60.28 | 29967540 | |
328 | Ubiquitination | LKLEENIKTAEEQGE HHHHHHHHHHHHHHH | 53.95 | 29967540 | |
342 | Ubiquitination | ELAFQDAKTKLAQLE HHHHHHHHHHHHHHH | 55.25 | 29967540 | |
344 | Ubiquitination | AFQDAKTKLAQLEAA HHHHHHHHHHHHHHH | 40.91 | 29967540 | |
356 | Sumoylation | EAALQQAKQDMARQL HHHHHHHHHHHHHHH | 42.36 | - | |
356 | Sumoylation | EAALQQAKQDMARQL HHHHHHHHHHHHHHH | 42.36 | - | |
364 | Methylation | QDMARQLRKYQELMN HHHHHHHHHHHHHHC | 27.57 | 115387097 | |
366 | Phosphorylation | MARQLRKYQELMNVK HHHHHHHHHHHHCHH | 10.77 | 20068231 | |
396 | Phosphorylation | GEEGRMDSPSATVVS CCCCCCCCCHHHHHH | 16.06 | 21712546 | |
398 | Phosphorylation | EGRMDSPSATVVSAV CCCCCCCHHHHHHHH | 40.29 | 21815630 | |
400 | Phosphorylation | RMDSPSATVVSAVQS CCCCCHHHHHHHHHH | 26.27 | 21815630 | |
403 | Phosphorylation | SPSATVVSAVQSRCK CCHHHHHHHHHHHHH | 20.56 | 22199227 | |
407 | Phosphorylation | TVVSAVQSRCKTAAS HHHHHHHHHHHHHHH | 32.80 | 20068231 | |
407 (in isoform 2) | Phosphorylation | - | 32.80 | 20068231 | |
414 (in isoform 2) | Phosphorylation | - | 25.23 | - | |
416 | Phosphorylation | CKTAASRSGLSKAPS HHHHHHHCCCCCCCC | 41.41 | 23911959 | |
419 | Phosphorylation | AASRSGLSKAPSRKK HHHHCCCCCCCCCCC | 30.23 | 23911959 | |
420 | Ubiquitination | ASRSGLSKAPSRKKK HHHCCCCCCCCCCCC | 70.16 | 29967540 | |
423 | Phosphorylation | SGLSKAPSRKKKGSK CCCCCCCCCCCCCCC | 62.69 | 23532336 | |
429 | Phosphorylation | PSRKKKGSKGPVIKI CCCCCCCCCCCEEEH | 43.23 | 23911959 | |
435 | Sumoylation | GSKGPVIKITEMSEK CCCCCEEEHHHCCHH | 43.75 | - | |
435 | Sumoylation | GSKGPVIKITEMSEK CCCCCEEEHHHCCHH | 43.75 | - | |
437 | Phosphorylation | KGPVIKITEMSEKYF CCCEEEHHHCCHHHH | 22.19 | - | |
440 | Phosphorylation | VIKITEMSEKYFSQE EEEHHHCCHHHHCCC | 25.38 | 29396449 | |
443 | Phosphorylation | ITEMSEKYFSQESEV HHHCCHHHHCCCCCC | 12.38 | 29396449 | |
445 | Phosphorylation | EMSEKYFSQESEVSE HCCHHHHCCCCCCCC | 29.92 | 28355574 | |
448 | Phosphorylation | EKYFSQESEVSE--- HHHHCCCCCCCC--- | 35.34 | 29396449 | |
451 | Phosphorylation | FSQESEVSE------ HCCCCCCCC------ | 33.27 | 28355574 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of K2C80_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of K2C80_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of K2C80_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of K2C80_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-45 AND SER-396, AND MASSSPECTROMETRY. | |
"Kinase-selective enrichment enables quantitative phosphoproteomics ofthe kinome across the cell cycle."; Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,Greff Z., Keri G., Stemmann O., Mann M.; Mol. Cell 31:438-448(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-396, AND MASSSPECTROMETRY. |