dbPTM

K1C28_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	K1C28_HUMAN
UniProt AC	Q7Z3Y7
Protein Name	Keratin, type I cytoskeletal 28
Gene Name	KRT28 {ECO:0000312\|HGNC:HGNC:30842}
Organism	Homo sapiens (Human).
Sequence Length	464
Subcellular Localization	Cytoplasm .
Protein Description	Essential for the proper assembly of types I and II keratin protein complexes and the formation of keratin intermediate filaments in the inner root sheath (irs)..
Protein Sequence	MSLQFSNGSRHVCLRSGAGSVRPLNGGAGFAGSSACGGSVAGSEFSCALGGGLGSVPGGSHAGGALGNAACIGFAGSEGGLLSGNEKVTMQNLNDRLASYLDNVRALEEANAELERKIKGWYEKYGPGSCRGLDHDYSRYHLTIEDLKNKIISSTTTNANVILQIDNARLAADDFRLKYENELTLHQNVEADINGLRRVLDELTLCRTDQELQYESLSEEMTYLKKNHEEEMKALQCAAGGNVNVEMNAAPGVDLAVLLNNMRAEYEALAEQNRKDAEAWFNEKSASLQQQISHDSGAATFARSQLTEMRRTLQTLEIQLQSLMATKHSLECSLTETESNYCTQLAQIQAQIGALEEQLHQVRTETEGQKLEYEHLLDVKVHLEKEIETYCRLIDGDGNSCSKSKGFGSGSPGNSSKDLSKTTLVKTVVEELDQRGKVLSSRIHSIEEKTSKMTNGKTEQRVPF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
143	Phosphorylation	DYSRYHLTIEDLKNK CCCCEEEEHHHHHHC	14.70	22985185
155	Phosphorylation	KNKIISSTTTNANVI HHCCCEECCCCCEEE	30.74	24275569
156	Phosphorylation	NKIISSTTTNANVIL HCCCEECCCCCEEEE	21.72	24275569
179	Phosphorylation	ADDFRLKYENELTLH CCCHHEEECCCCEEC	28.69	24275569
275	Ubiquitination	ALAEQNRKDAEAWFN HHHHHHHHHHHHHHC	69.69	22817900
400	Phosphorylation	LIDGDGNSCSKSKGF EECCCCCCCCCCCCC	25.87	-
409	Phosphorylation	SKSKGFGSGSPGNSS CCCCCCCCCCCCCCC	33.56	21955146
411	Phosphorylation	SKGFGSGSPGNSSKD CCCCCCCCCCCCCCC	31.19	21955146
415	Phosphorylation	GSGSPGNSSKDLSKT CCCCCCCCCCCCCCH	44.68	21955146
416	Phosphorylation	SGSPGNSSKDLSKTT CCCCCCCCCCCCCHH	33.90	21955146
420	Phosphorylation	GNSSKDLSKTTLVKT CCCCCCCCCHHHHHH	37.78	21955146
441	Phosphorylation	QRGKVLSSRIHSIEE HHCCCHHHHHHHHHH	30.97	24719451
445	Phosphorylation	VLSSRIHSIEEKTSK CHHHHHHHHHHHHCC	29.35	23909892
450	Phosphorylation	IHSIEEKTSKMTNGK HHHHHHHHCCCCCCC	36.54	23909892
451	Phosphorylation	HSIEEKTSKMTNGKT HHHHHHHCCCCCCCC	31.34	23909892
454	Phosphorylation	EEKTSKMTNGKTEQR HHHHCCCCCCCCCCC	44.55	23909892

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of K1C28_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of K1C28_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of K1C28_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of K1C28_HUMAN !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of K1C28_HUMAN

Related Literatures of Post-Translational Modification