CYTA_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CYTA_HUMAN
• UniProt AC: P01040
• Protein Name: Cystatin-A
• Gene Name: CSTA
• Organism: Homo sapiens (Human).
• Sequence Length: 98
• Subcellular Localization: Cytoplasm .
• Protein Description: This is an intracellular thiol proteinase inhibitor. Has an important role in desmosome-mediated cell-cell adhesion in the lower levels of the epidermis..
• Protein Sequence: MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MIPGGLSE -------CCCCCCCC	8.23	-
37	Ubiquitination	KTNETYGKLEAVQYK HHCCCCCEEEEEEEE	32.51	22817900
37	Ubiquitination	KTNETYGKLEAVQYK HHCCCCCEEEEEEEE	32.51	21890473
45	Phosphorylation	LEAVQYKTQVVAGTN EEEEEEEEEEEECCC	22.97	23663014
51	Phosphorylation	KTQVVAGTNYYIKVR EEEEEECCCEEEEEE	15.43	23663014
53	Phosphorylation	QVVAGTNYYIKVRAG EEEECCCEEEEEECC	13.35	23663014
54	Phosphorylation	VVAGTNYYIKVRAGD EEECCCEEEEEECCC	9.06	23663014

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CYTA_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CYTA_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CYTA_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CATL1_HUMAN	CTSL	physical	12921779
CATH_HUMAN	CTSH	physical	12581647
CATB_HUMAN	CTSB	physical	9585570
CATL1_HUMAN	CTSL	physical	9585570
ELAF_HUMAN	PI3	physical	8999895
K2C1_HUMAN	KRT1	physical	8999895
LORI_HUMAN	LOR	physical	8999895
DESP_HUMAN	DSP	physical	8999895
INVO_HUMAN	IVL	physical	8999895
CYTA_HUMAN	CSTA	physical	11532941

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 607936: Ichthyosis, exfoliative, autosomal recessive, ichthyosis bullosa of Siemens-like (AREI)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.