UniProt ID | CATH_HUMAN | |
---|---|---|
UniProt AC | P09668 | |
Protein Name | Pro-cathepsin H | |
Gene Name | CTSH | |
Organism | Homo sapiens (Human). | |
Sequence Length | 335 | |
Subcellular Localization | Lysosome. | |
Protein Description | Important for the overall degradation of proteins in lysosomes.. | |
Protein Sequence | MWATLPLLCAGAWLLGVPVCGAAELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
68 | Ubiquitination | NWRKINAHNNGNHTF CHHHHHCCCCCCCCH | 24.65 | 21890473 | |
83 | Phosphorylation | KMALNQFSDMSFAEI HHHHHHCCCCCHHHH | 23.73 | 24732914 | |
86 | Phosphorylation | LNQFSDMSFAEIKHK HHHCCCCCHHHHHHH | 26.71 | 24732914 | |
88 | Ubiquitination | QFSDMSFAEIKHKYL HCCCCCHHHHHHHHH | 15.42 | 21890473 | |
94 | Phosphorylation | FAEIKHKYLWSEPQN HHHHHHHHHHCCCCC | 17.08 | 22115753 | |
97 | Phosphorylation | IKHKYLWSEPQNCSA HHHHHHHCCCCCCCC | 36.48 | 22115753 | |
101 | N-linked_Glycosylation | YLWSEPQNCSATKSN HHHCCCCCCCCCCCC | 32.21 | 3342889 | |
103 | Phosphorylation | WSEPQNCSATKSNYL HCCCCCCCCCCCCCC | 46.66 | 22115753 | |
105 | Phosphorylation | EPQNCSATKSNYLRG CCCCCCCCCCCCCCC | 20.79 | 22115753 | |
106 | Ubiquitination | PQNCSATKSNYLRGT CCCCCCCCCCCCCCC | 36.10 | 22817900 | |
106 | Ubiquitination | PQNCSATKSNYLRGT CCCCCCCCCCCCCCC | 36.10 | 21890473 | |
107 | Phosphorylation | QNCSATKSNYLRGTG CCCCCCCCCCCCCCC | 26.76 | 22115753 | |
109 | Phosphorylation | CSATKSNYLRGTGPY CCCCCCCCCCCCCCC | 12.60 | 22115753 | |
141 | S-nitrosylation | NQGACGSCWTFSTTG CCCCCCCCEEECCCC | 2.11 | 25040305 | |
204 | Phosphorylation | KGIMGEDTYPYQGKD CCCCCCCCCCCCCCC | 23.30 | 29083192 | |
205 | Phosphorylation | GIMGEDTYPYQGKDG CCCCCCCCCCCCCCC | 16.56 | 29083192 | |
207 | Phosphorylation | MGEDTYPYQGKDGYC CCCCCCCCCCCCCCC | 21.34 | 29083192 | |
230 | N-linked_Glycosylation | GFVKDVANITIYDEE EEEEECEEEEECCHH | 31.61 | 3342889 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CATH_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CATH_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CATH_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CATH_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry."; Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.; J. Proteome Res. 8:651-661(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-230, AND MASSSPECTROMETRY. | |
"Amino acid sequences of the human kidney cathepsins H and L."; Ritonja A., Popovic T., Kotnik M., Machleidt W., Turk V.; FEBS Lett. 228:341-345(1988). Cited for: PROTEIN SEQUENCE OF 98-105 AND 114-335, AND GLYCOSYLATION AT ASN-101AND ASN-230. |