LORI_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LORI_HUMAN
• UniProt AC: P23490
• Protein Name: Loricrin
• Gene Name: LOR
• Organism: Homo sapiens (Human).
• Sequence Length: 312
• Subcellular Localization: Cytoplasm. Nucleus, nucleoplasm.
• Protein Description: Major keratinocyte cell envelope protein..
• Protein Sequence: MSYQKKQPTPQPPVDCVKTSGGGGGGGGSGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSGGGGSGCFSSGGGGSSGGGSGCFSSGGGGSSGGGSGCFSSGGGGFSGQAVQCQSYGGVSSGGSSGGGSGCFSSGGGGGSVCGYSGGGSGCGGGSSGGSGSGYVSSQQVTQTSCAPQPSYGGGSSGGGGSGGSGCFSSGGGGGSSGCGGGSSGIGSGCIISGGGSVCGGGSSGGGGGGSSVGGSGSGKGVPICHQTQQKQAPTWPSK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MSYQKKQPTP -----CCCCCCCCCC	24.05	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LORI_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LORI_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LORI_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VIME_HUMAN	VIM	physical	16169070
LORI_HUMAN	LOR	physical	8999895

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 604117: Vohwinkel syndrome with ichthyosis (VSI)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.