| UniProt ID | CATB_HUMAN | |
|---|---|---|
| UniProt AC | P07858 | |
| Protein Name | Cathepsin B | |
| Gene Name | CTSB | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 339 | |
| Subcellular Localization | Lysosome . Melanosome. Secreted, extracellular space. Identified by mass spectrometry in melanosome fractions from stage I to stage IV. | |
| Protein Description | Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.. | |
| Protein Sequence | MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 33 | Phosphorylation | LSDELVNYVNKRNTT CCHHHHHHHHHCCCC | 9.64 | - | |
| 97 | Acetylation | WPQCPTIKEIRDQGS CCCCCCHHHHHHCCC | 49.95 | 26051181 | |
| 97 | 2-Hydroxyisobutyrylation | WPQCPTIKEIRDQGS CCCCCCHHHHHHCCC | 49.95 | - | |
| 169 | Phosphorylation | WTRKGLVSGGLYESH CCCCCCCCCCCCCCC | 31.99 | - | |
| 173 | Phosphorylation | GLVSGGLYESHVGCR CCCCCCCCCCCCCCC | 20.75 | - | |
| 192 | N-linked_Glycosylation | PPCEHHVNGSRPPCT CCCCCCCCCCCCCCC | 38.06 | 3463996 | |
| 211 | S-nitrosylation | TPKCSKICEPGYSPT CCCCCCCCCCCCCCC | 6.24 | 2212679 | |
| 215 | Phosphorylation | SKICEPGYSPTYKQD CCCCCCCCCCCCCCC | 23.38 | 28152594 | |
| 216 | Phosphorylation | KICEPGYSPTYKQDK CCCCCCCCCCCCCCC | 19.38 | 28152594 | |
| 218 | Phosphorylation | CEPGYSPTYKQDKHY CCCCCCCCCCCCCCC | 37.09 | 28152594 | |
| 219 | Phosphorylation | EPGYSPTYKQDKHYG CCCCCCCCCCCCCCC | 15.27 | 28152594 | |
| 220 | Ubiquitination | PGYSPTYKQDKHYGY CCCCCCCCCCCCCCC | 55.27 | 21890473 | |
| 220 | Malonylation | PGYSPTYKQDKHYGY CCCCCCCCCCCCCCC | 55.27 | 32601280 | |
| 220 | Acetylation | PGYSPTYKQDKHYGY CCCCCCCCCCCCCCC | 55.27 | 26210075 | |
| 220 | 2-Hydroxyisobutyrylation | PGYSPTYKQDKHYGY CCCCCCCCCCCCCCC | 55.27 | - | |
| 223 | Ubiquitination | SPTYKQDKHYGYNSY CCCCCCCCCCCCCCC | 35.91 | 21890473 | |
| 223 | 2-Hydroxyisobutyrylation | SPTYKQDKHYGYNSY CCCCCCCCCCCCCCC | 35.91 | - | |
| 235 | Phosphorylation | NSYSVSNSEKDIMAE CCCCCCCCCCHHHHH | 38.22 | 29116813 | |
| 237 | 2-Hydroxyisobutyrylation | YSVSNSEKDIMAEIY CCCCCCCCHHHHHHH | 52.99 | - | |
| 237 | Ubiquitination | YSVSNSEKDIMAEIY CCCCCCCCHHHHHHH | 52.99 | 21890473 | |
| 240 | Sulfoxidation | SNSEKDIMAEIYKNG CCCCCHHHHHHHHCC | 3.82 | 30846556 | |
| 244 | Phosphorylation | KDIMAEIYKNGPVEG CHHHHHHHHCCCCCC | 7.01 | 29116813 | |
| 274 | Sulfoxidation | YQHVTGEMMGGHAIR EEHHCCCEECCEEEE | 2.98 | 30846556 | |
| 275 | Sulfoxidation | QHVTGEMMGGHAIRI EHHCCCEECCEEEEE | 5.17 | 30846556 | |
| 319 | Glutathionylation | ILRGQDHCGIESEVV HHCCCCCCCCCEEEE | 8.70 | 22555962 | |
| 319 | S-nitrosylation | ILRGQDHCGIESEVV HHCCCCCCCCCEEEE | 8.70 | 25040305 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CATB_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CATB_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CATB_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CYTA_HUMAN | CSTA | physical | 14503883 | |
| CYTB_HUMAN | CSTB | physical | 14503883 | |
| CYTC_HUMAN | CST3 | physical | 14503883 | |
| BAG6_HUMAN | BAG6 | physical | 16169070 | |
| SH3K1_HUMAN | SH3KBP1 | physical | 16733801 | |
| A4_HUMAN | APP | physical | 21832049 | |
| EPCR_HUMAN | PROCR | physical | 22939629 | |
| PARP1_HUMAN | PARP1 | physical | 11536009 | |
| MLH1_HUMAN | MLH1 | physical | 20706999 | |
| MSI2H_HUMAN | MSI2 | physical | 26344197 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Nucleotide and predicted amino acid sequences of cloned human andmouse preprocathepsin B cDNAs."; Chan S.J., San Segundo B., McCormick M.B., Steiner D.F.; Proc. Natl. Acad. Sci. U.S.A. 83:7721-7725(1986). Cited for: NUCLEOTIDE SEQUENCE [MRNA], AND VARIANT VAL-26. | |
