dbPTM

CYTC_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CYTC_HUMAN
UniProt AC	P01034
Protein Name	Cystatin-C
Gene Name	CST3
Organism	Homo sapiens (Human).
Sequence Length	146
Subcellular Localization	Secreted .
Protein Description	As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity..
Protein Sequence	MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
43	Phosphorylation	VGGPMDASVEEEGVR CCCCCCCCHHHHHHH	26.29	28355574
67	Sulfoxidation	YNKASNDMYHSRALQ CCCCCCCCHHHHHHH	3.67	30846556
88	Phosphorylation	QIVAGVNYFLDVELG HHHCCCCEEEEEECC	11.78	27067055

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
43	S	Phosphorylation	Kinase	FAM20C	Q8IXL6	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Reference
20	A	Glycosylation	19838169
The signal peptide of the O-glycosylated Thr-25 variant is cleaved between Ala-20 and Val-21.
21	V	Glycosylation	19838169
The signal peptide of the O-glycosylated Thr-25 variant is cleaved between Ala-20 and Val-21.
25	T	Glycosylation	2764935
The Thr-25 variant is O-glycosylated with a core 1 or possibly core 8 glycan.
25	T	Glycosylation	2764935
The signal peptide of the O-glycosylated Thr-25 variant is cleaved between Ala-20 and Val-21.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CYTC_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of CYTC_HUMAN !!

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
105150	Amyloidosis 6 (AMYL6)
611953	Macular degeneration, age-related, 11 (ARMD11)
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CYTC_HUMAN

Related Literatures of Post-Translational Modification