| UniProt ID | CYTB_HUMAN | |
|---|---|---|
| UniProt AC | P04080 | |
| Protein Name | Cystatin-B | |
| Gene Name | CSTB | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 98 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.. | |
| Protein Sequence | MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MMCGAPSA -------CCCCCCCC | 4.53 | 22223895 | |
| 7 | Phosphorylation | -MMCGAPSATQPATA -CCCCCCCCCCCCCH | 43.33 | 28450419 | |
| 7 | O-linked_Glycosylation | -MMCGAPSATQPATA -CCCCCCCCCCCCCH | 43.33 | 30379171 | |
| 9 | Phosphorylation | MCGAPSATQPATAET CCCCCCCCCCCCHHH | 39.15 | 28450419 | |
| 9 | O-linked_Glycosylation | MCGAPSATQPATAET CCCCCCCCCCCCHHH | 39.15 | 30379171 | |
| 13 | Phosphorylation | PSATQPATAETQHIA CCCCCCCCHHHHHHH | 31.54 | 28450419 | |
| 13 | O-linked_Glycosylation | PSATQPATAETQHIA CCCCCCCCHHHHHHH | 31.54 | 30379171 | |
| 16 | Phosphorylation | TQPATAETQHIADQV CCCCCHHHHHHHHHH | 24.00 | 20068231 | |
| 16 | O-linked_Glycosylation | TQPATAETQHIADQV CCCCCHHHHHHHHHH | 24.00 | 30379171 | |
| 25 | O-linked_Glycosylation | HIADQVRSQLEEKEN HHHHHHHHHHHHHHH | 40.02 | 30379171 | |
| 34 | Acetylation | LEEKENKKFPVFKAV HHHHHHCCCCEEEEE | 67.49 | 26051181 | |
| 39 | Acetylation | NKKFPVFKAVSFKSQ HCCCCEEEEEEEECE | 48.38 | 25953088 | |
| 39 | Ubiquitination | NKKFPVFKAVSFKSQ HCCCCEEEEEEEECE | 48.38 | 21890473 | |
| 44 | Acetylation | VFKAVSFKSQVVAGT EEEEEEEECEEEECC | 32.26 | 25825284 | |
| 44 | Ubiquitination | VFKAVSFKSQVVAGT EEEEEEEECEEEECC | 32.26 | 21890473 | |
| 45 | Phosphorylation | FKAVSFKSQVVAGTN EEEEEEECEEEECCC | 26.63 | 26356563 | |
| 51 | Phosphorylation | KSQVVAGTNYFIKVH ECEEEECCCEEEEEE | 19.60 | 28152594 | |
| 53 | Phosphorylation | QVVAGTNYFIKVHVG EEEECCCEEEEEEEC | 13.40 | 28152594 | |
| 68 | Methylation | DEDFVHLRVFQSLPH CCCEEEEEEEECCCC | 16.60 | - | |
| 72 | Phosphorylation | VHLRVFQSLPHENKP EEEEEEECCCCCCCC | 32.19 | 24719451 | |
| 78 | Acetylation | QSLPHENKPLTLSNY ECCCCCCCCCEEECC | 38.12 | 23954790 | |
| 78 | Ubiquitination | QSLPHENKPLTLSNY ECCCCCCCCCEEECC | 38.12 | 19608861 | |
| 81 | Phosphorylation | PHENKPLTLSNYQTN CCCCCCCEEECCCCC | 36.35 | 24719451 | |
| 83 | Phosphorylation | ENKPLTLSNYQTNKA CCCCCEEECCCCCCC | 28.40 | 28152594 | |
| 85 | Phosphorylation | KPLTLSNYQTNKAKH CCCEEECCCCCCCCC | 17.22 | 24719451 | |
| 87 | Phosphorylation | LTLSNYQTNKAKHDE CEEECCCCCCCCCCC | 28.46 | 28152594 | |
| 91 | Ubiquitination | NYQTNKAKHDELTYF CCCCCCCCCCCCCCC | 53.88 | 19608861 | |
| 91 | Acetylation | NYQTNKAKHDELTYF CCCCCCCCCCCCCCC | 53.88 | 23236377 | |
| 91 | Malonylation | NYQTNKAKHDELTYF CCCCCCCCCCCCCCC | 53.88 | 26320211 | |
| 96 | Phosphorylation | KAKHDELTYF----- CCCCCCCCCC----- | 22.34 | 23403867 | |
| 97 | Phosphorylation | AKHDELTYF------ CCCCCCCCC------ | 21.66 | 25159151 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYTB_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYTB_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYTB_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CATH_HUMAN | CTSH | physical | 11514663 | |
| CATB_HUMAN | CTSB | physical | 11514663 | |
| CYTC_HUMAN | CST3 | physical | 1996959 | |
| METK2_HUMAN | MAT2A | physical | 22939629 | |
| NUDC_HUMAN | NUDC | physical | 22939629 | |
| FLNB_HUMAN | FLNB | physical | 22939629 | |
| SC24A_HUMAN | SEC24A | physical | 22939629 | |
| SARNP_HUMAN | SARNP | physical | 22863883 | |
| GSTT1_HUMAN | GSTT1 | physical | 26344197 | |
| PDCD6_HUMAN | PDCD6 | physical | 26344197 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 254800 | Epilepsy, progressive myoclonic 1 (EPM1) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. | |
| "Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-78 AND LYS-91, AND MASSSPECTROMETRY. | |
| Phosphorylation | |
| Reference | PubMed |
| "An extensive survey of tyrosine phosphorylation revealing new sitesin human mammary epithelial cells."; Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A.,Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D.,Wiley H.S., Qian W.-J.; J. Proteome Res. 8:3852-3861(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-97, AND MASSSPECTROMETRY. | |