UniProt ID | GSTT1_HUMAN | |
---|---|---|
UniProt AC | P30711 | |
Protein Name | Glutathione S-transferase theta-1 | |
Gene Name | GSTT1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 240 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Acts on 1,2-epoxy-3-(4-nitrophenoxy)propane, phenethylisothiocyanate 4-nitrobenzyl chloride and 4-nitrophenethyl bromide. Displays glutathione peroxidase activity with cumene hydroperoxide.. | |
Protein Sequence | MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
23 | Ubiquitination | AVYIFAKKNDIPFEL EEEEEECCCCCCEEE | 57.32 | - | |
52 | Ubiquitination | FAQVNPLKKVPALKD HHHCCCCCCCCCCCC | 53.64 | - | |
63 | Phosphorylation | ALKDGDFTLTESVAI CCCCCCCCCCHHHHH | 37.19 | 29978859 | |
65 | Phosphorylation | KDGDFTLTESVAILL CCCCCCCCHHHHHHH | 24.13 | 29978859 | |
67 | Phosphorylation | GDFTLTESVAILLYL CCCCCCHHHHHHHHH | 16.18 | 29978859 | |
73 | Phosphorylation | ESVAILLYLTRKYKV HHHHHHHHHHHHCCC | 11.55 | 29978859 | |
75 | Phosphorylation | VAILLYLTRKYKVPD HHHHHHHHHHCCCCC | 16.14 | 29978859 | |
83 | Phosphorylation | RKYKVPDYWYPQDLQ HHCCCCCCCCCHHHH | 10.77 | 27259358 | |
85 | Phosphorylation | YKVPDYWYPQDLQAR CCCCCCCCCHHHHHH | 5.70 | 27259358 | |
216 | Ubiquitination | EAHEVILKAKDFPPA HHHHHHHHCCCCCCC | 42.12 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSTT1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSTT1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSTT1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TRI18_HUMAN | MID1 | physical | 28514442 | |
MYLK2_HUMAN | MYLK2 | physical | 28514442 | |
HBB_HUMAN | HBB | physical | 28514442 | |
SIR2_HUMAN | SIRT2 | physical | 28514442 | |
TRY2_HUMAN | PRSS2 | physical | 28514442 | |
SPRTN_HUMAN | SPRTN | physical | 28514442 | |
LURA1_HUMAN | LURAP1 | physical | 28514442 |
loading...