UniProt ID | PDCD6_HUMAN | |
---|---|---|
UniProt AC | O75340 | |
Protein Name | Programmed cell death protein 6 | |
Gene Name | PDCD6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 191 | |
Subcellular Localization |
Endoplasmic reticulum membrane Peripheral membrane protein . Cytoplasmic vesicle, COPII-coated vesicle membrane . Cytoplasm . Nucleus . Endosome . Interaction with RBM22 induces relocalization from the cytoplasm to the nucleus (PubMed:17045351). Tr |
|
Protein Description | Calcium sensor that plays a key role in processes such as endoplasmic reticulum (ER)-Golgi vesicular transport, endosomal biogenesis or membrane repair. Acts as an adapter that bridges unrelated proteins or stabilizes weak protein-protein complexes in response to calcium: calcium-binding triggers exposure of apolar surface, promoting interaction with different sets of proteins thanks to 3 different hydrophobic pockets, leading to translocation to membranes. [PubMed: 20691033] | |
Protein Sequence | MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAAYSYRPG ------CCCCCCCCC | 18.33 | 22223895 | |
4 | Phosphorylation | ----MAAYSYRPGPG ----CCCCCCCCCCC | 9.19 | 24173317 | |
5 | Phosphorylation | ---MAAYSYRPGPGA ---CCCCCCCCCCCC | 15.22 | 25159151 | |
34 | Methylation | FLWNVFQRVDKDRSG HHHHHHHHHCCCCCC | 27.43 | 115383731 | |
40 | Phosphorylation | QRVDKDRSGVISDTE HHHCCCCCCCCCHHH | 47.77 | 30622161 | |
44 | Phosphorylation | KDRSGVISDTELQQA CCCCCCCCHHHHHHH | 35.75 | 25332170 | |
46 | Phosphorylation | RSGVISDTELQQALS CCCCCCHHHHHHHHH | 31.63 | 28787133 | |
53 | Phosphorylation | TELQQALSNGTWTPF HHHHHHHHCCCCCCC | 35.91 | 21712546 | |
56 | Phosphorylation | QQALSNGTWTPFNPV HHHHHCCCCCCCCCC | 30.34 | 28787133 | |
58 | Phosphorylation | ALSNGTWTPFNPVTV HHHCCCCCCCCCCHH | 20.17 | 28787133 | |
64 | Phosphorylation | WTPFNPVTVRSIISM CCCCCCCHHHHHHHH | 16.09 | 25332170 | |
67 | Phosphorylation | FNPVTVRSIISMFDR CCCCHHHHHHHHHCC | 21.67 | 20363803 | |
70 | Phosphorylation | VTVRSIISMFDRENK CHHHHHHHHHCCCCC | 16.24 | 20363803 | |
71 | Sulfoxidation | TVRSIISMFDRENKA HHHHHHHHHCCCCCC | 2.59 | 21406390 | |
74 | Methylation | SIISMFDRENKAGVN HHHHHHCCCCCCCCC | 37.82 | 115486745 | |
77 | Ubiquitination | SMFDRENKAGVNFSE HHHCCCCCCCCCHHH | 41.59 | - | |
83 | Phosphorylation | NKAGVNFSEFTGVWK CCCCCCHHHHHCCHH | 26.96 | 21712546 | |
107 | Phosphorylation | RTYDRDNSGMIDKNE HHCCCCCCCCCCHHH | 33.74 | 25159151 | |
109 | Sulfoxidation | YDRDNSGMIDKNELK CCCCCCCCCCHHHHH | 3.43 | 21406390 | |
112 | Ubiquitination | DNSGMIDKNELKQAL CCCCCCCHHHHHHHH | 41.20 | - | |
112 | Acetylation | DNSGMIDKNELKQAL CCCCCCCHHHHHHHH | 41.20 | 26822725 | |
116 | Ubiquitination | MIDKNELKQALSGFG CCCHHHHHHHHHHCC | 27.61 | 21906983 | |
120 | Phosphorylation | NELKQALSGFGYRLS HHHHHHHHHCCCHHH | 34.78 | 20068231 | |
124 | Phosphorylation | QALSGFGYRLSDQFH HHHHHCCCHHHHHHH | 13.20 | 20068231 | |
127 | Phosphorylation | SGFGYRLSDQFHDIL HHCCCHHHHHHHHHH | 21.99 | 20873877 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PDCD6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PDCD6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PDCD6_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HEBP2_HUMAN | HEBP2 | physical | 16189514 | |
MISSL_HUMAN | MAPK1IP1L | physical | 16189514 | |
PDCD6_HUMAN | PDCD6 | physical | 16189514 | |
M3K5_HUMAN | MAP3K5 | physical | 12372597 | |
TNR6_HUMAN | FAS | physical | 11606059 | |
PDC6I_HUMAN | PDCD6IP | physical | 9880530 | |
PEF1_HUMAN | PEF1 | physical | 11278427 | |
PDC6I_HUMAN | PDCD6IP | physical | 11883939 | |
ANX11_HUMAN | ANXA11 | physical | 11883939 | |
PDC6I_HUMAN | PDCD6IP | physical | 18940611 | |
PEF1_HUMAN | PEF1 | physical | 21988832 | |
PDCD6_HUMAN | PDCD6 | physical | 21988832 | |
DAPK1_HUMAN | DAPK1 | physical | 16132846 | |
PDCD6_HUMAN | PDCD6 | physical | 25416956 | |
HEBP2_HUMAN | HEBP2 | physical | 25416956 | |
VP37C_HUMAN | VPS37C | physical | 25416956 | |
PEF1_HUMAN | PEF1 | physical | 25416956 | |
HNRPU_HUMAN | HNRNPU | physical | 26344197 | |
HNRL1_HUMAN | HNRNPUL1 | physical | 26344197 | |
HNRL2_HUMAN | HNRNPUL2 | physical | 26344197 | |
IF2B3_HUMAN | IGF2BP3 | physical | 26344197 | |
ITPA_HUMAN | ITPA | physical | 26344197 | |
MIF_HUMAN | MIF | physical | 26344197 | |
PCBP1_HUMAN | PCBP1 | physical | 26344197 | |
SAR1B_HUMAN | SAR1B | physical | 26344197 | |
FCL_HUMAN | TSTA3 | physical | 26344197 | |
PEF1_HUMAN | PEF1 | physical | 21516116 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...