| UniProt ID | PEF1_HUMAN | |
|---|---|---|
| UniProt AC | Q9UBV8 | |
| Protein Name | Peflin {ECO:0000303|PubMed:10486255} | |
| Gene Name | PEF1 {ECO:0000312|HGNC:HGNC:30009} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 284 | |
| Subcellular Localization |
Cytoplasm . Endoplasmic reticulum . Membrane Peripheral membrane protein . Cytoplasmic vesicle, COPII-coated vesicle membrane Peripheral membrane protein . Membrane-associated in the presence of Ca(2+) (PubMed:11278427). Localizes to endoplasmic |
|
| Protein Description | Calcium-binding protein that acts as an adapter that bridges unrelated proteins or stabilizes weak protein-protein complexes in response to calcium. Together with PDCD6, acts as calcium-dependent adapter for the BCR(KLHL12) complex, a complex involved in endoplasmic reticulum (ER)-Golgi transport by regulating the size of COPII coats. [PubMed: 27716508 In response to cytosolic calcium increase, the heterodimer formed with PDCD6 interacts with, and bridges together the BCR(KLHL12) complex and SEC31 (SEC31A or SEC31B), promoting monoubiquitination of SEC31 and subsequent collagen export, which is required for neural crest specification] | |
| Protein Sequence | MASYPYRQGCPGAAGQAPGAPPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAAPGGPYGQPPPSSYGAQQPGLYGQGGAPPNVDPEAYSWFQSVDSDHSGYISMKELKQALVNCNWSSFNDETCLMMINMFDKTKSGRIDVYGFSALWKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRYCPRSANPAMQLDRFIQVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTASRML | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MASYPYRQGC -----CCCCCCCCCC | 25.91 | 23186163 | |
| 7 | Dimethylation | -MASYPYRQGCPGAA -CCCCCCCCCCCCCC | 23.16 | - | |
| 7 | Methylation | -MASYPYRQGCPGAA -CCCCCCCCCCCCCC | 23.16 | 52719565 | |
| 133 | Phosphorylation | VDSDHSGYISMKELK CCCCCCCEECHHHHH | 7.88 | 22817900 | |
| 137 | Ubiquitination | HSGYISMKELKQALV CCCEECHHHHHHHHH | 53.77 | PubMed | |
| 165 | Ubiquitination | MMINMFDKTKSGRID EEEECCCCCCCCCCC | 46.73 | PubMed | |
| 166 | Phosphorylation | MINMFDKTKSGRIDV EEECCCCCCCCCCCE | 32.08 | 29759185 | |
| 167 | Ubiquitination | INMFDKTKSGRIDVY EECCCCCCCCCCCEE | 57.56 | PubMed | |
| 168 | Phosphorylation | NMFDKTKSGRIDVYG ECCCCCCCCCCCEEH | 38.24 | 29759185 | |
| 174 | Phosphorylation | KSGRIDVYGFSALWK CCCCCCEEHHHHHHH | 14.54 | 29759185 | |
| 177 | Phosphorylation | RIDVYGFSALWKFIQ CCCEEHHHHHHHHHH | 20.35 | 29759185 | |
| 200 | Phosphorylation | YDRDRSGSISYTELQ HCCCCCCCCCHHHHH | 15.03 | - | |
| 202 | Phosphorylation | RDRSGSISYTELQQA CCCCCCCCHHHHHHH | 27.92 | - | |
| 211 | Phosphorylation | TELQQALSQMGYNLS HHHHHHHHHCCCCCC | 22.57 | 22210691 | |
| 218 | Phosphorylation | SQMGYNLSPQFTQLL HHCCCCCCHHHHHHH | 17.02 | 22210691 | |
| 222 | Phosphorylation | YNLSPQFTQLLVSRY CCCCHHHHHHHHHHH | 17.04 | 22210691 | |
| 227 | Phosphorylation | QFTQLLVSRYCPRSA HHHHHHHHHHCCCCC | 19.94 | 22210691 | |
| 260 | 2-Hydroxyisobutyrylation | LTEAFREKDTAVQGN HHHHHHCCCCCCCCC | 57.00 | - | |
| 260 | Ubiquitination | LTEAFREKDTAVQGN HHHHHHCCCCCCCCC | 57.00 | - |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PEF1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PEF1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PDCD6_HUMAN | PDCD6 | physical | 11278427 | |
| DAZP2_HUMAN | DAZAP2 | physical | 19060904 | |
| K0930_HUMAN | KIAA0930 | physical | 26186194 | |
| H2A2B_HUMAN | HIST2H2AB | physical | 26186194 | |
| FAS_HUMAN | FASN | physical | 26344197 | |
| PDCD6_HUMAN | PDCD6 | physical | 26344197 | |
| PDC6I_HUMAN | PDCD6IP | physical | 26344197 | |
| SUCB2_HUMAN | SUCLG2 | physical | 26344197 | |
| DMRTB_HUMAN | DMRTB1 | physical | 21516116 | |
| K0930_HUMAN | KIAA0930 | physical | 28514442 | |
| H2A2B_HUMAN | HIST2H2AB | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
