DMRTB_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DMRTB_HUMAN
• UniProt AC: Q96MA1
• Protein Name: Doublesex- and mab-3-related transcription factor B1
• Gene Name: DMRTB1
• Organism: Homo sapiens (Human).
• Sequence Length: 342
• Subcellular Localization: Nucleus .
• Protein Sequence: MADKMVRTPKCSRCRNHGFLVPVKGHAGKCRWKQCLCEKCYLISERQKIMAAQKVLKTQAAEEEQEAALCAQGPKQASGAAAAAPAPVPVPAASLRPLSPGTPSGDADPGPEGRAAACFFEQPPRGRNPGPRALQPVLGGRSHVEPSERAAVAMPSLAGPPFGAEAAGSGYPGPLDLRRPMRTVPGPLFTDFVRPLNINPDRALGPEYPGGSSMHPYCPFPLGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPLPPLPPLPPQPQFLPPGYLSALHFLPPPPPPPPPSSFSLTVLFDTDKENTDDQDAEVLSGEPSQPSSQEQSD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
142	Phosphorylation	QPVLGGRSHVEPSER CCCCCCCCCCCHHHH	34.85	24719451
156	Phosphorylation	RAAVAMPSLAGPPFG HHHHCCHHHCCCCCC	20.12	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DMRTB_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DMRTB_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DMRTB_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CA094_HUMAN	C1orf94	physical	21516116
TRI11_HUMAN	TRIM11	physical	28514442
KLH15_HUMAN	KLHL15	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.