ELAF_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ELAF_HUMAN
• UniProt AC: P19957
• Protein Name: Elafin
• Gene Name: PI3
• Organism: Homo sapiens (Human).
• Sequence Length: 117
• Subcellular Localization: Secreted.
• Protein Description: Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis..
• Protein Sequence: MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MRASSFLIVVVF ---CCHHHHHHHHHH	24.08	18491316
17	Phosphorylation	VVFLIAGTLVLEAAV HHHHHHHHHHHHHHH	12.50	18491316
25	Phosphorylation	LVLEAAVTGVPVKGQ HHHHHHHHCCCCCCC	27.95	18491316

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ELAF_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ELAF_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ELAF_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
K2C1_HUMAN	KRT1	physical	8999895
LORI_HUMAN	LOR	physical	8999895

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.