UniProt ID | INVO_HUMAN | |
---|---|---|
UniProt AC | P07476 | |
Protein Name | Involucrin | |
Gene Name | IVL | |
Organism | Homo sapiens (Human). | |
Sequence Length | 585 | |
Subcellular Localization | Cytoplasm. Constituent of the scaffolding of the cornified envelope. | |
Protein Description | Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia.. | |
Protein Sequence | MSQQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGLPEQECEQQQKEPQEQELQQQHWEQHEEYQKAENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKEQLLELPEQQEGHLKHLEQQEGQLKHPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPQQQEGQLELSEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQMGQLKYLEQQEGQLKHLDQQEKQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQEGQLEHLEHQEGQLGLPEQQVLQLKQLEKQQGQPKHLEEEEGQLKHLVQQEGQLKHLVQQEGQLEQQERQVEHLEQQVGQLKHLEEQEGQLKHLEQQQGQLEVPEQQVGQPKNLEQEEKQLELPEQQEGQVKHLEKQEAQLELPEQQVGQPKHLEQQEKHLEHPEQQDGQLKHLEQQEGQLKDLEQQKGQLEQPVFAPAPGQVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSQQHTLPV ------CCCCCCCCC | 38.25 | 26074081 | |
6 | Phosphorylation | --MSQQHTLPVTLSP --CCCCCCCCCCCCH | 28.55 | 26074081 | |
10 | Phosphorylation | QQHTLPVTLSPALSQ CCCCCCCCCCHHHCH | 21.41 | 26074081 | |
12 | Phosphorylation | HTLPVTLSPALSQEL CCCCCCCCHHHCHHH | 9.96 | 25394399 | |
16 | Phosphorylation | VTLSPALSQELLKTV CCCCHHHCHHHHHCC | 24.58 | 29888752 | |
22 | Phosphorylation | LSQELLKTVPPPVNT HCHHHHHCCCCCCCC | 37.91 | 24043423 | |
29 | Phosphorylation | TVPPPVNTHQEQMKQ CCCCCCCCCHHHHCC | 25.77 | 24043423 | |
65 | Phosphorylation | KQEEKHMTAVKGLPE HHHHHHHHHCCCCCH | 28.19 | - | |
79 | Hydroxyceramide ester | EQECEQQQKEPQEQE HHHHHHHHCCHHHHH | 52.34 | 9651377 | |
118 | Hydroxyceramide ester | EKTQRDQQLNKQLEE HHHHHHHHHHHHHHH | 51.82 | 9651377 | |
133 | Hydroxyceramide ester | EKKLLDQQLDQELVK HHHHHHHHHHHHHHH | 46.83 | 9651377 | |
314 | Acetylation | EQQMGQLKHLEQQEG HHHHHHHHHHHHHCC | 37.95 | 11792033 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of INVO_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of INVO_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of INVO_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
INVO_HUMAN | IVL | physical | 8999895 | |
LORI_HUMAN | LOR | physical | 8999895 | |
K2C1_HUMAN | KRT1 | physical | 8999895 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...