INVO_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: INVO_HUMAN
• UniProt AC: P07476
• Protein Name: Involucrin
• Gene Name: IVL
• Organism: Homo sapiens (Human).
• Sequence Length: 585
• Subcellular Localization: Cytoplasm. Constituent of the scaffolding of the cornified envelope.
• Protein Description: Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia..
• Protein Sequence: MSQQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGLPEQECEQQQKEPQEQELQQQHWEQHEEYQKAENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKEQLLELPEQQEGHLKHLEQQEGQLKHPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPEQQEGQLELPQQQEGQLELSEQQEGQLELSEQQEGQLKHLEHQEGQLEVPEEQMGQLKYLEQQEGQLKHLDQQEKQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHLEQQEGQLEHLEHQEGQLGLPEQQVLQLKQLEKQQGQPKHLEEEEGQLKHLVQQEGQLKHLVQQEGQLEQQERQVEHLEQQVGQLKHLEEQEGQLKHLEQQQGQLEVPEQQVGQPKNLEQEEKQLELPEQQEGQVKHLEKQEAQLELPEQQVGQPKHLEQQEKHLEHPEQQDGQLKHLEQQEGQLKDLEQQKGQLEQPVFAPAPGQVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSQQHTLPV ------CCCCCCCCC	38.25	26074081
6	Phosphorylation	--MSQQHTLPVTLSP --CCCCCCCCCCCCH	28.55	26074081
10	Phosphorylation	QQHTLPVTLSPALSQ CCCCCCCCCCHHHCH	21.41	26074081
12	Phosphorylation	HTLPVTLSPALSQEL CCCCCCCCHHHCHHH	9.96	25394399
16	Phosphorylation	VTLSPALSQELLKTV CCCCHHHCHHHHHCC	24.58	29888752
22	Phosphorylation	LSQELLKTVPPPVNT HCHHHHHCCCCCCCC	37.91	24043423
29	Phosphorylation	TVPPPVNTHQEQMKQ CCCCCCCCCHHHHCC	25.77	24043423
65	Phosphorylation	KQEEKHMTAVKGLPE HHHHHHHHHCCCCCH	28.19	-
79	Hydroxyceramide ester	EQECEQQQKEPQEQE HHHHHHHHCCHHHHH	52.34	9651377
118	Hydroxyceramide ester	EKTQRDQQLNKQLEE HHHHHHHHHHHHHHH	51.82	9651377
133	Hydroxyceramide ester	EKKLLDQQLDQELVK HHHHHHHHHHHHHHH	46.83	9651377
314	Acetylation	EQQMGQLKHLEQQEG HHHHHHHHHHHHHCC	37.95	11792033

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of INVO_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of INVO_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of INVO_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
INVO_HUMAN	IVL	physical	8999895
LORI_HUMAN	LOR	physical	8999895
K2C1_HUMAN	KRT1	physical	8999895

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.