UniProt ID | PA2GA_HUMAN | |
---|---|---|
UniProt AC | P14555 | |
Protein Name | Phospholipase A2, membrane associated | |
Gene Name | PLA2G2A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 144 | |
Subcellular Localization |
Cell membrane Peripheral membrane protein . Secreted . |
|
Protein Description | Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. [PubMed: 2925633 Thought to participate in the regulation of phospholipid metabolism in biomembranes including eicosanoid biosynthesis. Independent of its catalytic activity, acts as a ligand for integrins] | |
Protein Sequence | MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
82 | Ubiquitination | EKRGCGTKFLSYKFS HHCCCCCEEEEEECC | 29.59 | - | |
86 | Phosphorylation | CGTKFLSYKFSNSGS CCCEEEEEECCCCCC | 20.42 | 21403953 | |
128 | Sumoylation | NKTTYNKKYQYYSNK CCCCCCHHEEEECCC | 33.67 | - | |
128 | Sumoylation | NKTTYNKKYQYYSNK CCCCCCHHEEEECCC | 33.67 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PA2GA_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PA2GA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PA2GA_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PGS2_HUMAN | DCN | physical | 10747008 | |
CEP70_HUMAN | CEP70 | physical | 21900206 | |
BAG6_HUMAN | BAG6 | physical | 21900206 | |
PA2GA_HUMAN | PLA2G2A | physical | 15299314 | |
PA2GA_HUMAN | PLA2G2A | physical | 1948070 | |
PA2GA_HUMAN | PLA2G2A | physical | 8831753 | |
PA2GA_HUMAN | PLA2G2A | physical | 12616631 | |
VIME_HUMAN | VIM | physical | 12829607 | |
LOX12_HUMAN | ALOX12 | physical | 15474031 | |
ITAV_HUMAN | ITGAV | physical | 18635536 | |
ITB3_HUMAN | ITGB3 | physical | 18635536 | |
TGM2_HUMAN | TGM2 | physical | 23913269 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...