UniProt ID | S10AE_HUMAN | |
---|---|---|
UniProt AC | Q9HCY8 | |
Protein Name | Protein S100-A14 | |
Gene Name | S100A14 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 104 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium.. | |
Protein Sequence | MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MGQCRSANAEDAQ --CCCCCCCCHHHHH | 33.24 | 24719451 | |
16 | Phosphorylation | AEDAQEFSDVERAIE HHHHHHHHHHHHHHH | 39.74 | - | |
27 | Acetylation | RAIETLIKNFHQYSV HHHHHHHHHHHHHHC | 57.59 | 133673 | |
27 | Ubiquitination | RAIETLIKNFHQYSV HHHHHHHHHHHHHHC | 57.59 | 21906983 | |
32 | Phosphorylation | LIKNFHQYSVEGGKE HHHHHHHHHCCCCCC | 13.20 | 19534553 | |
33 | Phosphorylation | IKNFHQYSVEGGKET HHHHHHHHCCCCCCC | 13.71 | 26356563 | |
38 | Ubiquitination | QYSVEGGKETLTPSE HHHCCCCCCCCCHHH | 59.38 | 21906983 | |
40 | Phosphorylation | SVEGGKETLTPSELR HCCCCCCCCCHHHHH | 39.14 | 16674116 | |
42 | Phosphorylation | EGGKETLTPSELRDL CCCCCCCCHHHHHHH | 31.99 | 27794612 | |
44 | Phosphorylation | GKETLTPSELRDLVT CCCCCCHHHHHHHHH | 43.99 | 27794612 | |
73 | Phosphorylation | EKIANLGSCNDSKLE HHHHHCCCCCCCHHH | 16.95 | 25056879 | |
77 | Phosphorylation | NLGSCNDSKLEFRSF HCCCCCCCHHHHHHH | 25.75 | 25056879 | |
78 | Ubiquitination | LGSCNDSKLEFRSFW CCCCCCCHHHHHHHH | 55.70 | 29901268 | |
83 | Phosphorylation | DSKLEFRSFWELIGE CCHHHHHHHHHHHHH | 39.78 | 23898821 | |
93 | Ubiquitination | ELIGEAAKSVKLERP HHHHHHHHHCCCCCC | 63.93 | 21906983 | |
96 | Ubiquitination | GEAAKSVKLERPVRG HHHHHHCCCCCCCCC | 52.28 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S10AE_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S10AE_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S10AE_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
S10AG_HUMAN | S100A16 | physical | 16189514 | |
S10AG_HUMAN | S100A16 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"An extensive survey of tyrosine phosphorylation revealing new sitesin human mammary epithelial cells."; Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A.,Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D.,Wiley H.S., Qian W.-J.; J. Proteome Res. 8:3852-3861(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-32, AND MASSSPECTROMETRY. |