dbPTM

S10AE_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	S10AE_HUMAN
UniProt AC	Q9HCY8
Protein Name	Protein S100-A14
Gene Name	S100A14
Organism	Homo sapiens (Human).
Sequence Length	104
Subcellular Localization	Cytoplasm .
Protein Description	Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium..
Protein Sequence	MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MGQCRSANAEDAQ --CCCCCCCCHHHHH	33.24	24719451
16	Phosphorylation	AEDAQEFSDVERAIE HHHHHHHHHHHHHHH	39.74	-
27	Acetylation	RAIETLIKNFHQYSV HHHHHHHHHHHHHHC	57.59	133673
27	Ubiquitination	RAIETLIKNFHQYSV HHHHHHHHHHHHHHC	57.59	21906983
32	Phosphorylation	LIKNFHQYSVEGGKE HHHHHHHHHCCCCCC	13.20	19534553
33	Phosphorylation	IKNFHQYSVEGGKET HHHHHHHHCCCCCCC	13.71	26356563
38	Ubiquitination	QYSVEGGKETLTPSE HHHCCCCCCCCCHHH	59.38	21906983
40	Phosphorylation	SVEGGKETLTPSELR HCCCCCCCCCHHHHH	39.14	16674116
42	Phosphorylation	EGGKETLTPSELRDL CCCCCCCCHHHHHHH	31.99	27794612
44	Phosphorylation	GKETLTPSELRDLVT CCCCCCHHHHHHHHH	43.99	27794612
73	Phosphorylation	EKIANLGSCNDSKLE HHHHHCCCCCCCHHH	16.95	25056879
77	Phosphorylation	NLGSCNDSKLEFRSF HCCCCCCCHHHHHHH	25.75	25056879
78	Ubiquitination	LGSCNDSKLEFRSFW CCCCCCCHHHHHHHH	55.70	29901268
83	Phosphorylation	DSKLEFRSFWELIGE CCHHHHHHHHHHHHH	39.78	23898821
93	Ubiquitination	ELIGEAAKSVKLERP HHHHHHHHHCCCCCC	63.93	21906983
96	Ubiquitination	GEAAKSVKLERPVRG HHHHHHCCCCCCCCC	52.28	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of S10AE_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of S10AE_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of S10AE_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
S10AG_HUMAN	S100A16	physical	16189514
S10AG_HUMAN	S100A16	physical	25416956

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of S10AE_HUMAN

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"An extensive survey of tyrosine phosphorylation revealing new sitesin human mammary epithelial cells."; Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A.,Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D.,Wiley H.S., Qian W.-J.; J. Proteome Res. 8:3852-3861(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-32, AND MASSSPECTROMETRY.	19534553 [Abstract]