S10A7_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: S10A7_HUMAN
• UniProt AC: P31151
• Protein Name: Protein S100-A7
• Gene Name: S100A7
• Organism: Homo sapiens (Human).
• Sequence Length: 101
• Subcellular Localization: Cytoplasm . Secreted . Secreted by a non-classical secretory pathway.
• Protein Sequence: MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSNTQAERS ------CCCHHHHHH	48.89	8526920
2	Phosphorylation	------MSNTQAERS ------CCCHHHHHH	48.89	21406692
4	Phosphorylation	----MSNTQAERSII ----CCCHHHHHHHH	23.11	21406692
9	Phosphorylation	SNTQAERSIIGMIDM CCHHHHHHHHHHHHH	15.29	21406692
31	Phosphorylation	DDKIEKPSLLTMMKE CCCCCCCHHHHHHHH	47.26	20068231
34	Phosphorylation	IEKPSLLTMMKENFP CCCCHHHHHHHHHCC	22.10	20068231
45	Phosphorylation	ENFPNFLSACDKKGT HHCCCHHHHHCCCCC	23.78	23663014
52	Phosphorylation	SACDKKGTNYLADVF HHHCCCCCCHHHHHH	29.57	27251275
90	Phosphorylation	ATDYHKQSHGAAPCS HHHHHHHHCCCCCCC	28.79	23090842
97	Phosphorylation	SHGAAPCSGGSQ--- HCCCCCCCCCCC---	45.17	23090842
100	Phosphorylation	AAPCSGGSQ------ CCCCCCCCC------	35.92	22617229

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of S10A7_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of S10A7_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of S10A7_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FABP5_HUMAN	FABP5	physical	12839573
CSN5_HUMAN	COPS5	physical	12702588
FABP5_HUMAN	FABP5	physical	10331666
CSN5_HUMAN	COPS5	physical	15994944

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Acetylation

"Amino acid sequence analysis of human S100A7 (psoriasin) by tandemmass spectrometry.";
Burgisser D.M., Siegenthaler G., Kuster T., Hellman U., Hunziker P.,Birchler N., Heizmann C.W.;
Biochem. Biophys. Res. Commun. 217:257-263(1995).
Cited for: PROTEIN SEQUENCE OF 2-101, MASS SPECTROMETRY, AND ACETYLATION ATSER-2.
PubMed: 8526920