UniProt ID | ST1B1_HUMAN | |
---|---|---|
UniProt AC | O43704 | |
Protein Name | Sulfotransferase family cytosolic 1B member 1 | |
Gene Name | SULT1B1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 296 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine, reverse triiodothyronine and thyroxine.. | |
Protein Sequence | MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
36 | Phosphorylation | EKIEQFHSRPDDIVI HHHHHHHCCCCCEEE | 46.96 | - | |
52 | O-linked_Glycosylation | TYPKSGTTWVSEIID ECCCCCCCHHHHHHH | 27.65 | 29351928 | |
76 | Phosphorylation | KCKRGFITEKVPMLE HHHHCCCCCCCCEEE | 27.74 | 24043423 | |
92 | Phosphorylation | TLPGLRTSGIEQLEK CCCCCCHHCHHHHHH | 31.19 | 26657352 | |
128 | Phosphorylation | ENNCKMIYLARNAKD HCCCEEEEEECCCCC | 7.27 | 22817900 | |
170 | Phosphorylation | FLTGKVAYGSWFTHV HHCCCCHHCHHHHHH | 18.06 | 26074081 | |
172 | Phosphorylation | TGKVAYGSWFTHVKN CCCCHHCHHHHHHHH | 13.31 | 26074081 | |
175 | Phosphorylation | VAYGSWFTHVKNWWK CHHCHHHHHHHHHHH | 21.36 | 26074081 | |
193 | Phosphorylation | EHPILFLYYEDMKEN CCCEEEEEHHHHCCC | 9.47 | 27732954 | |
194 | Phosphorylation | HPILFLYYEDMKENP CCEEEEEHHHHCCCH | 13.96 | 27732954 | |
281 | Phosphorylation | NEKFDAIYETEMSKT HHHCCEEEEECCCHH | 20.65 | 23312004 | |
283 | Phosphorylation | KFDAIYETEMSKTAL HCCEEEEECCCHHHH | 21.73 | 23312004 | |
286 | Phosphorylation | AIYETEMSKTALQFR EEEEECCCHHHHHHH | 22.18 | 23312004 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ST1B1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ST1B1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ST1B1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ST1B1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...