UniProt ID | EDAD_HUMAN | |
---|---|---|
UniProt AC | Q8WWZ3 | |
Protein Name | Ectodysplasin-A receptor-associated adapter protein | |
Gene Name | EDARADD | |
Organism | Homo sapiens (Human). | |
Sequence Length | 215 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Adapter protein that interacts with EDAR DEATH domain and couples the receptor to EDA signaling pathway during morphogenesis of ectodermal organs. Mediates the activation of NF-kappa-B.. | |
Protein Sequence | MGLRTTKQMGRGTKAPGHQEDHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPRNSDMKNQGEENGFPDSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDPSRHF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MGLRTTKQMG -----CCCCCCCCCC | 4.20 | 27251275 | |
3 (in isoform 2) | Phosphorylation | - | 4.20 | 27251275 | |
5 | Phosphorylation | ---MGLRTTKQMGRG ---CCCCCCCCCCCC | 43.30 | - | |
162 | Phosphorylation | FLEQRPQSPTLEFLL HHHCCCCCCHHHHHH | 23.64 | 24719451 | |
164 | Phosphorylation | EQRPQSPTLEFLLRN HCCCCCCHHHHHHHC | 44.13 | 24719451 | |
175 | Phosphorylation | LLRNSQRTVGQLMEL HHHCCCCHHHHHHHH | 22.73 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EDAD_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EDAD_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EDAD_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TRAF2_HUMAN | TRAF2 | physical | 11882293 | |
TAB2_HUMAN | TAB2 | physical | 16251197 | |
TRAF6_HUMAN | TRAF6 | physical | 16251197 | |
M3K7_HUMAN | MAP3K7 | physical | 16251197 | |
TRAF6_HUMAN | TRAF6 | physical | 22924441 | |
EDAD_HUMAN | EDARADD | physical | 25416956 | |
SHPRH_HUMAN | SHPRH | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...