UniProt ID | SEPT3_HUMAN | |
---|---|---|
UniProt AC | Q9UH03 | |
Protein Name | Neuronal-specific septin-3 | |
Gene Name | 3-Sep | |
Organism | Homo sapiens (Human). | |
Sequence Length | 358 | |
Subcellular Localization | Cytoplasm. Cytoplasm, cytoskeleton. Cell junction, synapse. | |
Protein Description | Filament-forming cytoskeletal GTPase (By similarity). May play a role in cytokinesis (Potential).. | |
Protein Sequence | MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSKGLPETR ------CCCCCCCCH | 35.12 | 29978859 | |
8 | Phosphorylation | MSKGLPETRTDAAMS CCCCCCCCHHHHHHH | 36.61 | 29978859 | |
10 | Phosphorylation | KGLPETRTDAAMSEL CCCCCCHHHHHHHHC | 37.09 | 29978859 | |
15 | Phosphorylation | TRTDAAMSELVPEPR CHHHHHHHHCCCCCC | 24.05 | 24248375 | |
30 | Methylation | PKPAVPMKPMSINSN CCCCCCCCCCCCCCC | 31.34 | 23644510 | |
41 | Phosphorylation | INSNLLGYIGIDTII CCCCHHHHHCHHHHH | 8.92 | 24248375 | |
70 | Phosphorylation | NIMVVGQSGLGKSTL EEEEECCCCCCHHHH | 30.01 | - | |
84 | Phosphorylation | LVNTLFKSQVSRKAS HHHHHHHHHHHHHCC | 28.60 | - | |
87 | Phosphorylation | TLFKSQVSRKASSWN HHHHHHHHHHCCCCC | 22.04 | - | |
91 | Phosphorylation | SQVSRKASSWNREEK HHHHHHCCCCCCCCC | 38.63 | 15107017 | |
92 | Phosphorylation | QVSRKASSWNREEKI HHHHHCCCCCCCCCC | 32.98 | - | |
118 | Ubiquitination | VIEEGGVKMKLTVID EHHHCCEEEEEEEEE | 33.32 | 30230243 | |
155 | Ubiquitination | EQYEKFLKEEVNIAR HHHHHHHHHHHHHHH | 55.77 | 32142685 | |
221 | Ubiquitination | LEEKSEFKQRVRKEL HHHHHHHHHHHHHHH | 32.89 | 23000965 | |
226 | Ubiquitination | EFKQRVRKELEVNGI HHHHHHHHHHHHCCE | 64.89 | 23000965 | |
226 | Acetylation | EFKQRVRKELEVNGI HHHHHHHHHHHHCCE | 64.89 | 11688629 | |
226 (in isoform 1) | Ubiquitination | - | 64.89 | 21890473 | |
226 (in isoform 2) | Ubiquitination | - | 64.89 | 21890473 | |
616 | Ubiquitination | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | 30230243 | ||
653 | Ubiquitination | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | 32142685 | ||
719 | Ubiquitination | -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | 23000965 | ||
724 | Ubiquitination | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEPT3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
91 | S | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEPT3_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...