UniProt ID | PCMD2_HUMAN | |
---|---|---|
UniProt AC | Q9NV79 | |
Protein Name | Protein-L-isoaspartate O-methyltransferase domain-containing protein 2 | |
Gene Name | PCMTD2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 361 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | ||
Protein Sequence | MGGAVSAGEDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLAWKHGNIHLSAPCIYSEVMEALDLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEYAKQKLDFFIRTSDSFDKFDFCEPSFVTGNCLEISPDCSQYDRVYCGAGVQKEHEEYMKNLLKVGGILVMPLEEKLTKITRTGPSAWETKKILAVSFAPLIQPCHSESGKSRLVQLPPVAVRSLQDLARIAIRGTIKKIIHQETVSKNGNGLKNTPRFKRRRVRRRRMETIVFLDKEVFASRISNPSDDNSCEDLEEERREEEEKTPPETKPDPPVNFLRQKVLSLPLPDPLKYYLLYYREK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGGAVSAGE ------CCCCCCCCC | 32.54 | - | |
6 | Phosphorylation | --MGGAVSAGEDNDE --CCCCCCCCCCCHH | 29.98 | 21722762 | |
47 | Ubiquitination | DYYLEEFKENAYKDL HHHHHHHHHHHHHHH | 54.03 | 22817900 | |
47 (in isoform 2) | Ubiquitination | - | 54.03 | 21890473 | |
47 (in isoform 1) | Ubiquitination | - | 54.03 | 21890473 | |
52 | Ubiquitination | EFKENAYKDLAWKHG HHHHHHHHHHHHHCC | 43.80 | 22817900 | |
71 (in isoform 3) | Ubiquitination | - | 28.98 | 21890473 | |
122 | Ubiquitination | SDVIEYAKQKLDFFI HHHHHHHHHHHCEEE | 47.25 | 22817900 | |
124 | Ubiquitination | VIEYAKQKLDFFIRT HHHHHHHHHCEEEEC | 49.68 | 21890473 | |
124 (in isoform 2) | Ubiquitination | - | 49.68 | 21890473 | |
124 (in isoform 1) | Ubiquitination | - | 49.68 | 21890473 | |
134 | Phosphorylation | FFIRTSDSFDKFDFC EEEECCCCCCCCCCC | 34.80 | 25627689 | |
171 | Ubiquitination | YCGAGVQKEHEEYMK ECCCCCHHHHHHHHH | 59.64 | 29967540 | |
182 | Ubiquitination | EYMKNLLKVGGILVM HHHHHHHHHCCEEEE | 41.84 | - | |
194 | Ubiquitination | LVMPLEEKLTKITRT EEEEHHHHHHHHHCC | 52.67 | 22817900 | |
194 (in isoform 1) | Ubiquitination | - | 52.67 | 21890473 | |
197 | Ubiquitination | PLEEKLTKITRTGPS EHHHHHHHHHCCCCC | 53.14 | 22817900 | |
229 | Ubiquitination | PCHSESGKSRLVQLP CCCCCCCCCCEECCC | 41.50 | - | |
229 | Acetylation | PCHSESGKSRLVQLP CCCCCCCCCCEECCC | 41.50 | 25953088 | |
230 | Ubiquitination | CHSESGKSRLVQLPP CCCCCCCCCEECCCH | 34.08 | 29967540 | |
257 | Ubiquitination | AIRGTIKKIIHQETV HHHHHHHHHHCHHHH | 42.94 | 29967540 | |
263 | Phosphorylation | KKIIHQETVSKNGNG HHHHCHHHHCCCCCC | 24.41 | 22673903 | |
265 | Phosphorylation | IIHQETVSKNGNGLK HHCHHHHCCCCCCCC | 28.02 | 22673903 | |
268 | Ubiquitination | QETVSKNGNGLKNTP HHHHCCCCCCCCCCH | 33.06 | 33845483 | |
268 (in isoform 2) | Ubiquitination | - | 33.06 | 21890473 | |
274 | Phosphorylation | NGNGLKNTPRFKRRR CCCCCCCCHHHHHHH | 17.79 | 25849741 | |
295 | Ubiquitination | ETIVFLDKEVFASRI EEEEEECHHHHHHHC | 58.90 | 22817900 | |
295 (in isoform 1) | Ubiquitination | - | 58.90 | 21890473 | |
303 | Phosphorylation | EVFASRISNPSDDNS HHHHHHCCCCCCCCC | 41.39 | 25850435 | |
306 | Phosphorylation | ASRISNPSDDNSCED HHHCCCCCCCCCCHH | 62.94 | 25849741 | |
310 | Phosphorylation | SNPSDDNSCEDLEEE CCCCCCCCCHHHHHH | 26.36 | 30576142 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PCMD2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PCMD2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PCMD2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CUL5_HUMAN | CUL5 | physical | 18187417 | |
ELOB_HUMAN | TCEB2 | physical | 18187417 | |
ELOC_HUMAN | TCEB1 | physical | 18187417 | |
CUL2_HUMAN | CUL2 | physical | 18187417 | |
VAC14_HUMAN | VAC14 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...