| UniProt ID | SEP11_HUMAN | |
|---|---|---|
| UniProt AC | Q9NVA2 | |
| Protein Name | Septin-11 | |
| Gene Name | 11-Sep | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 429 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. Cell junction, synapse. Cell projection, dendritic spine. Cell projection, axon. Partly colocalizes with stress fibers and microtubules. During bacterial infection, displays a collar shape structure next to actin at the pole | |
| Protein Description | Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential). May play a role in the cytoarchitecture of neurons, including dendritic arborization and dendritic spines, and in GABAergic synaptic connectivity (By similarity). During Listeria monocytogenes infection, not required for the bacterial entry process, but restricts its efficacy.. | |
| Protein Sequence | MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVNNFQKKKAAAQLLQSQAQQSGAQQTKKDKDKKNASFT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAVAVGRPS ------CCEECCCCC | 9.66 | 12665801 | |
| 9 | Phosphorylation | AVAVGRPSNEELRNL CEECCCCCHHHHHCC | 56.35 | 29255136 | |
| 9 | O-linked_Glycosylation | AVAVGRPSNEELRNL CEECCCCCHHHHHCC | 56.35 | 23301498 | |
| 17 | Phosphorylation | NEELRNLSLSGHVGF HHHHHCCCCCCCCCC | 24.84 | 28450419 | |
| 19 | Phosphorylation | ELRNLSLSGHVGFDS HHHCCCCCCCCCCCC | 24.39 | 28450419 | |
| 26 | Phosphorylation | SGHVGFDSLPDQLVN CCCCCCCCCCHHHCC | 39.27 | 26699800 | |
| 46 | Glutathionylation | GFCFNILCVGETGIG CCCEEEEEECCCCCC | 3.06 | 22555962 | |
| 50 | Phosphorylation | NILCVGETGIGKSTL EEEEECCCCCCHHHH | 28.33 | - | |
| 55 | Phosphorylation | GETGIGKSTLMDTLF CCCCCCHHHHHHHHH | 22.89 | 21712546 | |
| 56 | Phosphorylation | ETGIGKSTLMDTLFN CCCCCHHHHHHHHHC | 29.59 | 21712546 | |
| 64 | Phosphorylation | LMDTLFNTKFESDPA HHHHHHCCCCCCCCC | 29.76 | 21712546 | |
| 65 | Ubiquitination | MDTLFNTKFESDPAT HHHHHCCCCCCCCCC | 48.52 | - | |
| 65 | Acetylation | MDTLFNTKFESDPAT HHHHHCCCCCCCCCC | 48.52 | 26051181 | |
| 75 (in isoform 2) | Ubiquitination | - | 35.51 | - | |
| 84 | Phosphorylation | GVRLKARSYELQESN CCEEEEEEEECHHCC | 28.02 | 28152594 | |
| 85 | Phosphorylation | VRLKARSYELQESNV CEEEEEEEECHHCCC | 18.33 | 28152594 | |
| 90 | Phosphorylation | RSYELQESNVRLKLT EEEECHHCCCEEEEE | 27.88 | 24076635 | |
| 145 | Phosphorylation | SLFNYHDTRIHACLY HHHCCHHHHHEEEEE | 20.43 | - | |
| 163 | Phosphorylation | PTGHSLKSLDLVTMK CCCCCCCCCCEEEHH | 32.20 | 20068231 | |
| 168 | Phosphorylation | LKSLDLVTMKKLDSK CCCCCEEEHHHCCCC | 30.48 | 20068231 | |
| 170 | Ubiquitination | SLDLVTMKKLDSKVN CCCEEEHHHCCCCCC | 40.60 | - | |
| 175 | Ubiquitination | TMKKLDSKVNIIPII EHHHCCCCCCEEEEE | 38.68 | - | |
| 184 | Ubiquitination | NIIPIIAKADTIAKN CEEEEEECCCHHHHH | 36.06 | - | |
| 190 | Acetylation | AKADTIAKNELHKFK ECCCHHHHHHHHHHH | 47.29 | 25953088 | |
| 190 | Malonylation | AKADTIAKNELHKFK ECCCHHHHHHHHHHH | 47.29 | 26320211 | |
| 194 (in isoform 2) | Ubiquitination | - | 27.59 | - | |
| 294 | Phosphorylation | EQTHTRHYELYRRCK HHHHHHHHHHHHHHC | 12.35 | - | |
| 297 | Phosphorylation | HTRHYELYRRCKLEE HHHHHHHHHHHCHHH | 5.53 | - | |
| 301 | Ubiquitination | YELYRRCKLEEMGFK HHHHHHHCHHHCCCC | 58.06 | - | |
| 308 | Ubiquitination | KLEEMGFKDTDPDSK CHHHCCCCCCCCCCC | 54.73 | - | |
| 310 | Phosphorylation | EEMGFKDTDPDSKPF HHCCCCCCCCCCCCC | 50.45 | - | |
| 311 (in isoform 2) | Ubiquitination | - | 55.96 | - | |
| 314 | Phosphorylation | FKDTDPDSKPFSLQE CCCCCCCCCCCCHHH | 47.84 | - | |
| 315 | Ubiquitination | KDTDPDSKPFSLQET CCCCCCCCCCCHHHH | 58.42 | - | |
| 318 (in isoform 2) | Ubiquitination | - | 37.36 | - | |
| 318 | Phosphorylation | DPDSKPFSLQETYEA CCCCCCCCHHHHHHH | 37.36 | 26657352 | |
| 322 | Phosphorylation | KPFSLQETYEAKRNE CCCCHHHHHHHHHHH | 17.44 | 25627689 | |
| 323 | Phosphorylation | PFSLQETYEAKRNEF CCCHHHHHHHHHHHH | 17.09 | 25159151 | |
| 325 (in isoform 2) | Ubiquitination | - | 12.99 | - | |
| 325 | Ubiquitination | SLQETYEAKRNEFLG CHHHHHHHHHHHHHH | 12.99 | 21906983 | |
| 326 (in isoform 1) | Ubiquitination | - | 43.76 | 21890473 | |
| 326 | Ubiquitination | LQETYEAKRNEFLGE HHHHHHHHHHHHHHH | 43.76 | - | |
| 336 | Ubiquitination | EFLGELQKKEEEMRQ HHHHHHHHHHHHHHH | 74.83 | - | |
| 336 (in isoform 2) | Ubiquitination | - | 74.83 | 21890473 | |
| 337 | Ubiquitination | FLGELQKKEEEMRQM HHHHHHHHHHHHHHH | 58.35 | - | |
| 346 (in isoform 2) | Ubiquitination | - | 1.69 | - | |
| 347 (in isoform 2) | Ubiquitination | - | 2.52 | - | |
| 357 | Ubiquitination | KEKEAELKEAEKELH HHHHHHHHHHHHHHH | 46.51 | - | |
| 361 | Acetylation | AELKEAEKELHEKFD HHHHHHHHHHHHHHH | 73.04 | 28735889 | |
| 366 | Ubiquitination | AEKELHEKFDLLKRT HHHHHHHHHHHHHHH | 33.17 | - | |
| 367 (in isoform 2) | Ubiquitination | - | 7.93 | - | |
| 378 | Acetylation | KRTHQEEKKKVEDKK HHHHHHHHHHHHHHH | 58.08 | 30592309 | |
| 381 (in isoform 2) | Ubiquitination | - | 18.47 | - | |
| 388 (in isoform 2) | Ubiquitination | - | 16.05 | - | |
| 397 | Acetylation | EEVNNFQKKKAAAQL HHHHHHHHHHHHHHH | 52.70 | 26051181 | |
| 397 | Succinylation | EEVNNFQKKKAAAQL HHHHHHHHHHHHHHH | 52.70 | 23954790 | |
| 399 | Ubiquitination | VNNFQKKKAAAQLLQ HHHHHHHHHHHHHHH | 50.74 | - | |
| 399 | Malonylation | VNNFQKKKAAAQLLQ HHHHHHHHHHHHHHH | 50.74 | 26320211 | |
| 407 | Phosphorylation | AAAQLLQSQAQQSGA HHHHHHHHHHHHHCC | 27.70 | 25850435 | |
| 412 | Phosphorylation | LQSQAQQSGAQQTKK HHHHHHHHCCHHCHH | 24.82 | 25850435 | |
| 417 | Phosphorylation | QQSGAQQTKKDKDKK HHHCCHHCHHHHCCC | 28.16 | 30242111 | |
| 418 | Ubiquitination | QSGAQQTKKDKDKKN HHCCHHCHHHHCCCC | 55.42 | - | |
| 418 | Acetylation | QSGAQQTKKDKDKKN HHCCHHCHHHHCCCC | 55.42 | 26051181 | |
| 418 | Malonylation | QSGAQQTKKDKDKKN HHCCHHCHHHHCCCC | 55.42 | 26320211 | |
| 427 | Phosphorylation | DKDKKNASFT----- HHCCCCCCCC----- | 38.52 | 26853621 | |
| 428 | Ubiquitination | KDKKNASFT------ HCCCCCCCC------ | 9.74 | 21906983 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEP11_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEP11_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEP11_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SEPT9_HUMAN | SEPT9 | physical | 22939629 | |
| SEPT7_HUMAN | SEPT7 | physical | 22939629 | |
| SEPT5_HUMAN | SEPT5 | physical | 22939629 | |
| TM189_HUMAN | TMEM189 | physical | 22939629 | |
| STIM1_HUMAN | STIM1 | physical | 22939629 | |
| SUCA_HUMAN | SUCLG1 | physical | 22939629 | |
| XRCC1_HUMAN | XRCC1 | physical | 22939629 | |
| SIN3A_HUMAN | SIN3A | physical | 22939629 | |
| THTR_HUMAN | TST | physical | 22939629 | |
| TCOF_HUMAN | TCOF1 | physical | 22939629 | |
| TOM40_HUMAN | TOMM40 | physical | 22939629 | |
| SOSB1_HUMAN | NABP2 | physical | 22939629 | |
| TM177_HUMAN | TMEM177 | physical | 22939629 | |
| TMEM9_HUMAN | TMEM9 | physical | 22939629 | |
| VDAC2_HUMAN | VDAC2 | physical | 22939629 | |
| SMCA2_HUMAN | SMARCA2 | physical | 22939629 | |
| THTM_HUMAN | MPST | physical | 22939629 | |
| SF01_HUMAN | SF1 | physical | 22939629 | |
| SEPT5_HUMAN | SEPT5 | physical | 26344197 | |
| SEPT9_HUMAN | SEPT9 | physical | 26344197 | |
| PRCC_HUMAN | PRCC | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. | |
| "Exploring proteomes and analyzing protein processing by massspectrometric identification of sorted N-terminal peptides."; Gevaert K., Goethals M., Martens L., Van Damme J., Staes A.,Thomas G.R., Vandekerckhove J.; Nat. Biotechnol. 21:566-569(2003). Cited for: PROTEIN SEQUENCE OF 2-14 (ISOFORM 1), AND ACETYLATION AT ALA-2. | |