| UniProt ID | TOM40_HUMAN | |
|---|---|---|
| UniProt AC | O96008 | |
| Protein Name | Mitochondrial import receptor subunit TOM40 homolog | |
| Gene Name | TOMM40 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 361 | |
| Subcellular Localization |
Mitochondrion outer membrane Multi-pass membrane protein . |
|
| Protein Description | Channel-forming protein essential for import of protein precursors into mitochondria.. | |
| Protein Sequence | MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 36 | O-linked_Glycosylation | PPSPPGFTLPPLGGS CCCCCCCCCCCCCCC | 44.25 | OGP | |
| 57 | Phosphorylation | TSRSSERTPGAATAS CCCCCCCCCCCCCCC | 23.25 | 26471730 | |
| 62 | Phosphorylation | ERTPGAATASASGAA CCCCCCCCCCCCCCC | 22.17 | 26471730 | |
| 64 | Phosphorylation | TPGAATASASGAAED CCCCCCCCCCCCCCC | 20.72 | 26471730 | |
| 66 | Phosphorylation | GAATASASGAAEDGA CCCCCCCCCCCCCCC | 26.86 | 26471730 | |
| 91 | Acetylation | EECHRKCKELFPIQM HHHHHHHHHHCCCCE | 61.56 | 26051181 | |
| 91 | Ubiquitination | EECHRKCKELFPIQM HHHHHHHHHHCCCCE | 61.56 | 29967540 | |
| 102 | Ubiquitination | PIQMEGVKLTVNKGL CCCEEEEEEEECCCC | 49.66 | 32015554 | |
| 129 | Phosphorylation | STIGESNYHFGVTYV EECCCCCEEEEEEEE | 14.06 | - | |
| 142 | Phosphorylation | YVGTKQLSPTEAFPV EEECCCCCCCCCCCE | 27.55 | 25850435 | |
| 144 | Phosphorylation | GTKQLSPTEAFPVLV ECCCCCCCCCCCEEE | 36.25 | 25850435 | |
| 157 | Phosphorylation | LVGDMDNSGSLNAQV EEECCCCCCCCCHHH | 26.04 | 28102081 | |
| 159 | Phosphorylation | GDMDNSGSLNAQVIH ECCCCCCCCCHHHHH | 20.47 | 28102081 | |
| 175 | 2-Hydroxyisobutyrylation | LGPGLRSKMAIQTQQ HCCCHHHCEEEEECH | 26.39 | - | |
| 175 (in isoform 1) | Ubiquitination | - | 26.39 | 21890473 | |
| 175 (in isoform 2) | Ubiquitination | - | 26.39 | 21890473 | |
| 175 | Ubiquitination | LGPGLRSKMAIQTQQ HCCCHHHCEEEEECH | 26.39 | 21906983 | |
| 184 (in isoform 1) | Ubiquitination | - | 49.33 | 21890473 | |
| 184 (in isoform 2) | Ubiquitination | - | 49.33 | 21890473 | |
| 184 | Ubiquitination | AIQTQQSKFVNWQVD EEEECHHHCCCEEEC | 49.33 | 21963094 | |
| 194 | Phosphorylation | NWQVDGEYRGSDFTA CEEECCCCCCCCEEE | 26.29 | 21406692 | |
| 248 | Sulfoxidation | PGEEGTVMSLAGKYT CCCCCCEEEECEEEE | 2.46 | 28465586 | |
| 254 | Phosphorylation | VMSLAGKYTLNNWLA EEEECEEEEECCEEE | 18.62 | - | |
| 255 | Phosphorylation | MSLAGKYTLNNWLAT EEECEEEEECCEEEE | 26.88 | - | |
| 273 | Phosphorylation | GQAGMHATYYHKASD CCCCCEEEEEEECCC | 15.21 | - | |
| 291 | Phosphorylation | VGVEFEASTRMQDTS EEEEEEEECCCEECE | 14.89 | 20860994 | |
| 294 | Sulfoxidation | EFEASTRMQDTSVSF EEEEECCCEECEEEE | 4.24 | 28183972 | |
| 309 (in isoform 1) | Ubiquitination | - | 58.15 | 21890473 | |
| 309 | Ubiquitination | GYQLDLPKANLLFKG EEECCCCCCCEEEEC | 58.15 | 22817900 | |
| 309 (in isoform 2) | Ubiquitination | - | 58.15 | 21890473 | |
| 317 | Phosphorylation | ANLLFKGSVDSNWIV CCEEEECCCCCCEEE | 24.28 | 21712546 | |
| 320 | Phosphorylation | LFKGSVDSNWIVGAT EEECCCCCCEEEECC | 31.72 | 21712546 | |
| 327 | Phosphorylation | SNWIVGATLEKKLPP CCEEEECCCCCCCCC | 29.53 | 24719451 | |
| 330 | 2-Hydroxyisobutyrylation | IVGATLEKKLPPLPL EEECCCCCCCCCCCH | 63.82 | - | |
| 330 | Acetylation | IVGATLEKKLPPLPL EEECCCCCCCCCCCH | 63.82 | 26051181 | |
| 338 | Phosphorylation | KLPPLPLTLALGAFL CCCCCCHHHHHHHHH | 14.19 | 20068231 | |
| 351 | Acetylation | FLNHRKNKFQCGFGL HHHHCCCCCCCCCCC | 39.59 | 26051181 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TOM40_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TOM40_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TOM40_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
