UniProt ID | COX5B_HUMAN | |
---|---|---|
UniProt AC | P10606 | |
Protein Name | Cytochrome c oxidase subunit 5B, mitochondrial | |
Gene Name | COX5B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 129 | |
Subcellular Localization | Mitochondrion inner membrane. | |
Protein Description | This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.. | |
Protein Sequence | MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MASRLLRGAG -----CHHHHHHHHH | 23.35 | 20860994 | |
30 | Phosphorylation | SGAAAMRSMASGGGV CHHHHHHHHHCCCCC | 12.96 | 20068231 | |
33 | Phosphorylation | AAMRSMASGGGVPTD HHHHHHHCCCCCCCC | 29.36 | 22210691 | |
39 | Phosphorylation | ASGGGVPTDEEQATG HCCCCCCCCHHHHHC | 54.35 | 20068231 | |
45 | Phosphorylation | PTDEEQATGLEREIM CCCHHHHHCCHHHHH | 41.83 | 20068231 | |
56 | Acetylation | REIMLAAKKGLDPYN HHHHHHHHCCCCCCC | 41.59 | 25953088 | |
56 | Succinylation | REIMLAAKKGLDPYN HHHHHHHHCCCCCCC | 41.59 | 27452117 | |
56 | Malonylation | REIMLAAKKGLDPYN HHHHHHHHCCCCCCC | 41.59 | 26320211 | |
56 | 2-Hydroxyisobutyrylation | REIMLAAKKGLDPYN HHHHHHHHCCCCCCC | 41.59 | - | |
56 | Ubiquitination | REIMLAAKKGLDPYN HHHHHHHHCCCCCCC | 41.59 | - | |
57 | Ubiquitination | EIMLAAKKGLDPYNV HHHHHHHCCCCCCCC | 61.04 | 21890473 | |
57 | Acetylation | EIMLAAKKGLDPYNV HHHHHHHCCCCCCCC | 61.04 | 25038526 | |
57 | Ubiquitination | EIMLAAKKGLDPYNV HHHHHHHCCCCCCCC | 61.04 | 21890473 | |
57 | Malonylation | EIMLAAKKGLDPYNV HHHHHHHCCCCCCCC | 61.04 | 26320211 | |
62 | Phosphorylation | AKKGLDPYNVLAPKG HHCCCCCCCCCCCCC | 19.98 | 28152594 | |
68 | Ubiquitination | PYNVLAPKGASGTRE CCCCCCCCCCCCCCC | 62.59 | 21890473 | |
68 | Ubiquitination | PYNVLAPKGASGTRE CCCCCCCCCCCCCCC | 62.59 | 21890473 | |
68 | Acetylation | PYNVLAPKGASGTRE CCCCCCCCCCCCCCC | 62.59 | 30584465 | |
68 | Malonylation | PYNVLAPKGASGTRE CCCCCCCCCCCCCCC | 62.59 | 26320211 | |
71 | Phosphorylation | VLAPKGASGTREDPN CCCCCCCCCCCCCCC | 49.74 | 17349628 | |
73 | Phosphorylation | APKGASGTREDPNLV CCCCCCCCCCCCCCC | 28.52 | 26437602 | |
84 | Phosphorylation | PNLVPSISNKRIVGC CCCCCCCCCCEEEEE | 40.41 | 26437602 | |
86 | 2-Hydroxyisobutyrylation | LVPSISNKRIVGCIC CCCCCCCCEEEEEEE | 36.39 | - | |
86 | Ubiquitination | LVPSISNKRIVGCIC CCCCCCCCEEEEEEE | 36.39 | 21890473 | |
86 | Acetylation | LVPSISNKRIVGCIC CCCCCCCCEEEEEEE | 36.39 | 25953088 | |
86 | Ubiquitination | LVPSISNKRIVGCIC CCCCCCCCEEEEEEE | 36.39 | 21890473 | |
107 | Acetylation | VVWFWLHKGEAQRCP EEEEEEECCCHHCCC | 57.17 | 25825284 | |
121 | Acetylation | PRCGAHYKLVPQQLA CCCCCCEEECHHHHC | 32.89 | 19608861 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX5B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX5B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX5B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ODP2_HUMAN | DLAT | physical | 22939629 | |
K1C15_HUMAN | KRT15 | physical | 25416956 | |
K1H1_HUMAN | KRT31 | physical | 25416956 | |
TRAF1_HUMAN | TRAF1 | physical | 25416956 | |
BHE40_HUMAN | BHLHE40 | physical | 25416956 | |
PNMA1_HUMAN | PNMA1 | physical | 25416956 | |
TFP11_HUMAN | TFIP11 | physical | 25416956 | |
IHO1_HUMAN | CCDC36 | physical | 25416956 | |
COX2_HUMAN | COX2 | physical | 26344197 | |
PPIL3_HUMAN | PPIL3 | physical | 26344197 | |
RLA2_HUMAN | RPLP2 | physical | 26344197 | |
IHO1_HUMAN | CCDC36 | physical | 21516116 | |
TRI23_HUMAN | TRIM23 | physical | 21516116 | |
F208B_HUMAN | FAM208B | physical | 21516116 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB02659 | Cholic Acid |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-121, AND MASS SPECTROMETRY. |