UniProt ID | PPIL3_HUMAN | |
---|---|---|
UniProt AC | Q9H2H8 | |
Protein Name | Peptidyl-prolyl cis-trans isomerase-like 3 | |
Gene Name | PPIL3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 161 | |
Subcellular Localization | ||
Protein Description | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing.. | |
Protein Sequence | MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSVTLHTDV ------CCEEEEECC | 24.65 | 22223895 | |
7 | Phosphorylation | -MSVTLHTDVGDIKI -CCEEEEECCCCEEE | 35.18 | 21060948 | |
47 (in isoform 1) | Ubiquitination | - | 50.04 | 21890473 | |
47 | Ubiquitination | CIFHRNIKGFMVQTG EEEECCCCEEEEEEC | 50.04 | 21890473 | |
50 | Sulfoxidation | HRNIKGFMVQTGDPT ECCCCEEEEEECCCC | 2.73 | 21406390 | |
53 | Phosphorylation | IKGFMVQTGDPTGTG CCEEEEEECCCCCCC | 31.94 | 20068231 | |
61 | Methylation | GDPTGTGRGGNSIWG CCCCCCCCCCCCCCC | 50.08 | 30988933 | |
69 | Acetylation | GGNSIWGKKFEDEYS CCCCCCCCCCHHHHH | 39.01 | 23749302 | |
70 | Ubiquitination | GNSIWGKKFEDEYSE CCCCCCCCCHHHHHH | 50.47 | - | |
75 | Phosphorylation | GKKFEDEYSEYLKHN CCCCHHHHHHHHHHH | 21.08 | 29978859 | |
76 | Phosphorylation | KKFEDEYSEYLKHNV CCCHHHHHHHHHHHH | 20.09 | 29978859 | |
78 | Phosphorylation | FEDEYSEYLKHNVRG CHHHHHHHHHHHHCC | 18.34 | 29978859 | |
80 | Ubiquitination | DEYSEYLKHNVRGVV HHHHHHHHHHHCCEE | 32.03 | - | |
120 | Ubiquitination | MKYTVFGKVIDGLET CEEEECCEEECCCCC | 25.26 | - | |
127 | Phosphorylation | KVIDGLETLDELEKL EEECCCCCHHHHHCC | 44.55 | - | |
133 | Ubiquitination | ETLDELEKLPVNEKT CCHHHHHCCCCCCCC | 71.38 | 2190698 | |
133 (in isoform 1) | Ubiquitination | - | 71.38 | 21890473 | |
137 (in isoform 2) | Ubiquitination | - | 43.01 | 21906983 | |
139 | Acetylation | EKLPVNEKTYRPLND HCCCCCCCCCCCCCC | 45.73 | 26051181 | |
139 | Ubiquitination | EKLPVNEKTYRPLND HCCCCCCCCCCCCCC | 45.73 | - | |
142 | Methylation | PVNEKTYRPLNDVHI CCCCCCCCCCCCCEE | 34.17 | 115368667 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PPIL3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PPIL3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PPIL3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SPS1_HUMAN | SEPHS1 | physical | 22939629 | |
SUMO1_HUMAN | SUMO1 | physical | 22939629 | |
PSA1_HUMAN | PSMA1 | physical | 22939629 | |
SLD5_HUMAN | GINS4 | physical | 22939629 | |
SAHH2_HUMAN | AHCYL1 | physical | 22939629 | |
TMOD3_HUMAN | TMOD3 | physical | 22939629 | |
RD23B_HUMAN | RAD23B | physical | 22939629 | |
SC24C_HUMAN | SEC24C | physical | 22939629 | |
RCN1_HUMAN | RCN1 | physical | 22939629 | |
RPAP1_HUMAN | RPAP1 | physical | 22939629 | |
SGT1_HUMAN | SUGT1 | physical | 22939629 | |
SLU7_HUMAN | SLU7 | physical | 22365833 | |
PCBP1_HUMAN | PCBP1 | physical | 22365833 | |
BAG1_HUMAN | BAG1 | physical | 26344197 | |
TAGL2_HUMAN | TAGLN2 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...