| UniProt ID | RCN1_HUMAN | |
|---|---|---|
| UniProt AC | Q15293 | |
| Protein Name | Reticulocalbin-1 | |
| Gene Name | RCN1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 331 | |
| Subcellular Localization | Endoplasmic reticulum lumen. | |
| Protein Description | May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.. | |
| Protein Sequence | MARGGRGRRLGLALGLLLALVLAPRVLRAKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 43 | Phosphorylation | ERVVRPDSELGERPP HHEECCCCCCCCCCC | 37.09 | 29457462 | |
| 53 | N-linked_Glycosylation | GERPPEDNQSFQYDH CCCCCCCCCCCCCCH | 37.42 | 19159218 | |
| 54 | Ubiquitination | ERPPEDNQSFQYDHE CCCCCCCCCCCCCHH | 58.92 | - | |
| 55 | Phosphorylation | RPPEDNQSFQYDHEA CCCCCCCCCCCCHHH | 22.14 | 25850435 | |
| 55 | O-linked_Glycosylation | RPPEDNQSFQYDHEA CCCCCCCCCCCCHHH | 22.14 | 30059200 | |
| 58 | Phosphorylation | EDNQSFQYDHEAFLG CCCCCCCCCHHHHCC | 19.77 | 25850435 | |
| 69 | Phosphorylation | AFLGKEDSKTFDQLT HHCCCCCCCCHHHCC | 34.39 | 23312004 | |
| 70 | Ubiquitination | FLGKEDSKTFDQLTP HCCCCCCCCHHHCCC | 66.58 | 21890473 | |
| 70 | 2-Hydroxyisobutyrylation | FLGKEDSKTFDQLTP HCCCCCCCCHHHCCC | 66.58 | - | |
| 70 | Acetylation | FLGKEDSKTFDQLTP HCCCCCCCCHHHCCC | 66.58 | 27452117 | |
| 70 | Ubiquitination | FLGKEDSKTFDQLTP HCCCCCCCCHHHCCC | 66.58 | 21890473 | |
| 71 | Ubiquitination | LGKEDSKTFDQLTPD CCCCCCCCHHHCCCC | 36.07 | - | |
| 71 | Phosphorylation | LGKEDSKTFDQLTPD CCCCCCCCHHHCCCC | 36.07 | 25159151 | |
| 76 | Phosphorylation | SKTFDQLTPDESKER CCCHHHCCCCHHHHH | 24.06 | 20068231 | |
| 80 | Phosphorylation | DQLTPDESKERLGKI HHCCCCHHHHHHHHH | 47.39 | 29255136 | |
| 81 | Sumoylation | QLTPDESKERLGKIV HCCCCHHHHHHHHHH | 44.82 | - | |
| 81 | 2-Hydroxyisobutyrylation | QLTPDESKERLGKIV HCCCCHHHHHHHHHH | 44.82 | - | |
| 81 | Acetylation | QLTPDESKERLGKIV HCCCCHHHHHHHHHH | 44.82 | 23236377 | |
| 81 | Methylation | QLTPDESKERLGKIV HCCCCHHHHHHHHHH | 44.82 | - | |
| 83 | Methylation | TPDESKERLGKIVDR CCCHHHHHHHHHHHH | 53.10 | 24411213 | |
| 86 | Ubiquitination | ESKERLGKIVDRIDN HHHHHHHHHHHHHCC | 44.12 | 21890473 | |
| 86 | Acetylation | ESKERLGKIVDRIDN HHHHHHHHHHHHHCC | 44.12 | 19608861 | |
| 86 | Ubiquitination | ESKERLGKIVDRIDN HHHHHHHHHHHHHCC | 44.12 | 21890473 | |
| 90 | Ubiquitination | RLGKIVDRIDNDGDG HHHHHHHHHCCCCCC | 27.54 | - | |
| 90 | Methylation | RLGKIVDRIDNDGDG HHHHHHHHHCCCCCC | 27.54 | 115490981 | |
| 100 | Phosphorylation | NDGDGFVTTEELKTW CCCCCCEEHHHHHHH | 26.65 | - | |
| 101 | Phosphorylation | DGDGFVTTEELKTWI CCCCCEEHHHHHHHH | 23.35 | - | |
| 105 | Ubiquitination | FVTTEELKTWIKRVQ CEEHHHHHHHHHHHH | 45.13 | 21890473 | |
| 105 | Ubiquitination | FVTTEELKTWIKRVQ CEEHHHHHHHHHHHH | 45.13 | 21890473 | |
| 114 | Ubiquitination | WIKRVQKRYIFDNVA HHHHHHHHHHHHHHH | 16.82 | - | |
| 114 | Methylation | WIKRVQKRYIFDNVA HHHHHHHHHHHHHHH | 16.82 | 115490993 | |
| 115 | Phosphorylation | IKRVQKRYIFDNVAK HHHHHHHHHHHHHHH | 16.99 | 28152594 | |
| 122 | 2-Hydroxyisobutyrylation | YIFDNVAKVWKDYDR HHHHHHHHHHHHCCC | 44.33 | - | |
| 122 | Ubiquitination | YIFDNVAKVWKDYDR HHHHHHHHHHHHCCC | 44.33 | 21890473 | |
| 122 | Ubiquitination | YIFDNVAKVWKDYDR HHHHHHHHHHHHCCC | 44.33 | 21890473 | |
| 125 | 2-Hydroxyisobutyrylation | DNVAKVWKDYDRDKD HHHHHHHHHCCCCCC | 49.77 | - | |
| 125 | Ubiquitination | DNVAKVWKDYDRDKD HHHHHHHHHCCCCCC | 49.77 | - | |
| 134 | 2-Hydroxyisobutyrylation | YDRDKDDKISWEEYK CCCCCCCCCCHHHHH | 49.09 | - | |
| 134 | Acetylation | YDRDKDDKISWEEYK CCCCCCCCCCHHHHH | 49.09 | 26051181 | |
| 134 | Ubiquitination | YDRDKDDKISWEEYK CCCCCCCCCCHHHHH | 49.09 | - | |
| 136 | Phosphorylation | RDKDDKISWEEYKQA CCCCCCCCHHHHHHH | 33.89 | 25159151 | |
| 141 | Ubiquitination | KISWEEYKQATYGYY CCCHHHHHHHHCCCC | 36.41 | 21890473 | |
| 141 | Ubiquitination | KISWEEYKQATYGYY CCCHHHHHHHHCCCC | 36.41 | 21890473 | |
| 145 | Phosphorylation | EEYKQATYGYYLGNP HHHHHHHCCCCCCCH | 13.22 | 25884760 | |
| 147 | Phosphorylation | YKQATYGYYLGNPAE HHHHHCCCCCCCHHH | 5.77 | - | |
| 158 | Phosphorylation | NPAEFHDSSDHHTFK CHHHCCCCCCCHHHH | 29.15 | 25627689 | |
| 159 | Phosphorylation | PAEFHDSSDHHTFKK HHHCCCCCCCHHHHH | 47.20 | 25627689 | |
| 165 | 2-Hydroxyisobutyrylation | SSDHHTFKKMLPRDE CCCCHHHHHHCCCCH | 38.13 | - | |
| 165 | Ubiquitination | SSDHHTFKKMLPRDE CCCCHHHHHHCCCCH | 38.13 | 21890473 | |
| 165 | Acetylation | SSDHHTFKKMLPRDE CCCCHHHHHHCCCCH | 38.13 | 26051181 | |
| 165 | Ubiquitination | SSDHHTFKKMLPRDE CCCCHHHHHHCCCCH | 38.13 | 21890473 | |
| 166 | Acetylation | SDHHTFKKMLPRDER CCCHHHHHHCCCCHH | 41.29 | 156545 | |
| 176 | Ubiquitination | PRDERRFKAADLNGD CCCHHHHHHHHCCCC | 40.63 | 21890473 | |
| 176 | Ubiquitination | PRDERRFKAADLNGD CCCHHHHHHHHCCCC | 40.63 | 21890473 | |
| 176 | 2-Hydroxyisobutyrylation | PRDERRFKAADLNGD CCCHHHHHHHHCCCC | 40.63 | - | |
| 185 | Phosphorylation | ADLNGDLTATREEFT HHCCCCCCEEHHHHH | 30.62 | 25159151 | |
| 187 | Phosphorylation | LNGDLTATREEFTAF CCCCCCEEHHHHHHH | 33.12 | 21406692 | |
| 192 | Phosphorylation | TATREEFTAFLHPEE CEEHHHHHHHCCHHH | 21.56 | 25022875 | |
| 192 | O-linked_Glycosylation | TATREEFTAFLHPEE CEEHHHHHHHCCHHH | 21.56 | OGP | |
| 203 | Sulfoxidation | HPEEFEHMKEIVVLE CHHHHHHHHEEEEEE | 3.07 | 30846556 | |
| 211 | Phosphorylation | KEIVVLETLEDIDKN HEEEEEEEHHHHHHC | 31.14 | 23663014 | |
| 228 | Phosphorylation | GFVDQDEYIADMFSH CCCCHHHHHHHHHCC | 15.08 | 28102081 | |
| 234 | Phosphorylation | EYIADMFSHEENGPE HHHHHHHCCCCCCCC | 24.29 | 20071362 | |
| 249 | Methylation | PDWVLSEREQFNEFR CCCCCCHHHHHHHHH | 39.37 | 115490987 | |
| 263 | 2-Hydroxyisobutyrylation | RDLNKDGKLDKDEIR HHCCCCCCCCHHHHH | 64.74 | - | |
| 266 | Acetylation | NKDGKLDKDEIRHWI CCCCCCCHHHHHHHH | 68.63 | 26051181 | |
| 266 | 2-Hydroxyisobutyrylation | NKDGKLDKDEIRHWI CCCCCCCHHHHHHHH | 68.63 | - | |
| 270 | Methylation | KLDKDEIRHWILPQD CCCHHHHHHHHCCCC | 19.62 | 115490969 | |
| 278 | Phosphorylation | HWILPQDYDHAQAEA HHHCCCCCCHHHHHH | 12.37 | 27642862 | |
| 286 | Methylation | DHAQAEARHLVYESD CHHHHHHHHHHHHCC | 18.38 | 115490975 | |
| 290 | Phosphorylation | AEARHLVYESDKNKD HHHHHHHHHCCCCCC | 18.97 | 28152594 | |
| 292 | Phosphorylation | ARHLVYESDKNKDEK HHHHHHHCCCCCCCC | 35.88 | 28152594 | |
| 294 | Ubiquitination | HLVYESDKNKDEKLT HHHHHCCCCCCCCCC | 75.16 | - | |
| 294 | 2-Hydroxyisobutyrylation | HLVYESDKNKDEKLT HHHHHCCCCCCCCCC | 75.16 | - | |
| 296 | 2-Hydroxyisobutyrylation | VYESDKNKDEKLTKE HHHCCCCCCCCCCHH | 73.36 | - | |
| 299 | 2-Hydroxyisobutyrylation | SDKNKDEKLTKEEIL CCCCCCCCCCHHHHH | 72.14 | - | |
| 311 | Sulfoxidation | EILENWNMFVGSQAT HHHHHHHHHCCHHHH | 1.86 | 30846556 | |
| 315 | Phosphorylation | NWNMFVGSQATNYGE HHHHHCCHHHHCCCC | 16.02 | 23663014 | |
| 315 | O-linked_Glycosylation | NWNMFVGSQATNYGE HHHHHCCHHHHCCCC | 16.02 | OGP | |
| 318 | Phosphorylation | MFVGSQATNYGEDLT HHCCHHHHCCCCCCC | 22.72 | 23663014 | |
| 320 | Phosphorylation | VGSQATNYGEDLTKN CCHHHHCCCCCCCCC | 19.96 | 23663014 | |
| 325 | Phosphorylation | TNYGEDLTKNHDEL- HCCCCCCCCCCCCC- | 41.96 | 23663014 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 80 | S | Phosphorylation | Kinase | FAM20C | Q8IXL6 | Uniprot |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RCN1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RCN1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-86, AND MASS SPECTROMETRY. | |
| N-linked Glycosylation | |
| Reference | PubMed |
| "Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry."; Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.; J. Proteome Res. 8:651-661(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-53, AND MASS SPECTROMETRY. | |