UniProt ID | WIPI3_HUMAN | |
---|---|---|
UniProt AC | Q5MNZ6 | |
Protein Name | WD repeat domain phosphoinositide-interacting protein 3 | |
Gene Name | WDR45B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 344 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MNLLPCNPHGNGLLYAGFNQDHGCFACGMENGFRVYNTDPLKEKEKQEFLEGGVGHVEMLFRCNYLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVVVLDSMIKVFTFTHNPHQLHVFETCYNPKGLCVLCPNSNNSLLAFPGTHTGHVQLVDLASTEKPPVDIPAHEGVLSCIALNLQGTRIATASEKGTLIRIFDTSSGHLIQELRRGSQAANIYCINFNQDASLICVSSDHGTVHIFAAEDPKRNKQSSLASASFLPKYFSSKWSFSKFQVPSGSPCICAFGTEPNAVIAICADGSYYKFLFNPKGECIRDVYAQFLEMTDDKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
42 | Ubiquitination | VYNTDPLKEKEKQEF EECCCCCCHHHHHHH | 72.61 | 21906983 | |
44 | Ubiquitination | NTDPLKEKEKQEFLE CCCCCCHHHHHHHHH | 69.49 | 22817900 | |
46 | Ubiquitination | DPLKEKEKQEFLEGG CCCCHHHHHHHHHCC | 67.22 | 22817900 | |
65 | Phosphorylation | EMLFRCNYLALVGGG HHHHHCCEEEEECCC | 9.29 | 28152594 | |
88 | Ubiquitination | KVMIWDDLKKKTVIE CEEEEECCCCCEEEE | 8.98 | 23000965 | |
89 | Ubiquitination | VMIWDDLKKKTVIEI EEEEECCCCCEEEEE | 60.25 | 32015554 | |
92 | Phosphorylation | WDDLKKKTVIEIEFS EECCCCCEEEEEEEE | 35.28 | 28634298 | |
99 | Phosphorylation | TVIEIEFSTEVKAVK EEEEEEEECCEEEEE | 15.74 | 28634298 | |
100 | Phosphorylation | VIEIEFSTEVKAVKL EEEEEEECCEEEEEE | 50.55 | 28634298 | |
137 | Phosphorylation | HQLHVFETCYNPKGL CEEEEEEEEECCCCE | 14.61 | 22210691 | |
139 | Phosphorylation | LHVFETCYNPKGLCV EEEEEEEECCCCEEE | 41.75 | 22210691 | |
145 | Ubiquitination | CYNPKGLCVLCPNSN EECCCCEEEECCCCC | 2.75 | 23000965 | |
148 | Ubiquitination | PKGLCVLCPNSNNSL CCCEEEECCCCCCCE | 1.17 | 23000965 | |
160 | Ubiquitination | NSLLAFPGTHTGHVQ CCEEEECCCCCCEEE | 24.55 | 21890473 | |
165 | Ubiquitination | FPGTHTGHVQLVDLA ECCCCCCEEEEEECC | 12.81 | 23000965 | |
172 | Ubiquitination | HVQLVDLASTEKPPV EEEEEECCCCCCCCC | 15.22 | 23000965 | |
189 | Phosphorylation | PAHEGVLSCIALNLQ CCCCCHHHHEEEECC | 10.89 | 29759185 | |
202 | Phosphorylation | LQGTRIATASEKGTL CCCCEEEEECCCCCE | 28.48 | 29759185 | |
204 | Phosphorylation | GTRIATASEKGTLIR CCEEEEECCCCCEEE | 35.17 | 29759185 | |
206 | Malonylation | RIATASEKGTLIRIF EEEEECCCCCEEEEE | 55.49 | 26320211 | |
206 | 2-Hydroxyisobutyrylation | RIATASEKGTLIRIF EEEEECCCCCEEEEE | 55.49 | - | |
206 | Ubiquitination | RIATASEKGTLIRIF EEEEECCCCCEEEEE | 55.49 | 23000965 | |
229 | Ubiquitination | QELRRGSQAANIYCI HHHHHCCCCCEEEEE | 47.52 | 23000965 | |
232 | Ubiquitination | RRGSQAANIYCINFN HHCCCCCEEEEEECC | 28.86 | 23000965 | |
244 | Ubiquitination | NFNQDASLICVSSDH ECCCCCCEEEEECCC | 3.64 | 21890473 | |
249 | Ubiquitination | ASLICVSSDHGTVHI CCEEEEECCCCEEEE | 17.15 | 23000965 | |
263 | Ubiquitination | IFAAEDPKRNKQSSL EEEECCCCCCCCCCH | 79.51 | 23000965 | |
266 | Ubiquitination | AEDPKRNKQSSLASA ECCCCCCCCCCHHCH | 56.44 | 23000965 | |
278 | Ubiquitination | ASASFLPKYFSSKWS HCHHHCHHHHCCCCC | 62.16 | 23000965 | |
283 | Ubiquitination | LPKYFSSKWSFSKFQ CHHHHCCCCCCCCCC | 45.73 | 23000965 | |
285 | Phosphorylation | KYFSSKWSFSKFQVP HHHCCCCCCCCCCCC | 24.31 | 24719451 | |
325 | Ubiquitination | YKFLFNPKGECIRDV EEEEECCCCHHHHHH | 69.33 | 33845483 | |
333 | Phosphorylation | GECIRDVYAQFLEMT CHHHHHHHHHHHHHC | 10.04 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WIPI3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WIPI3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WIPI3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
UBX10_HUMAN | UBXN10 | physical | 26389662 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...