UniProt ID | ST1A1_HUMAN | |
---|---|---|
UniProt AC | P50225 | |
Protein Name | Sulfotransferase 1A1 | |
Gene Name | SULT1A1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 295 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.. | |
Protein Sequence | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Ubiquitination | RPPLEYVKGVPLIKY CCCCHHHCCCHHHHH | 53.97 | - | |
33 | Phosphorylation | EALGPLQSFQARPDD HHHCCHHHHCCCCCC | 27.32 | 28857561 | |
49 | Phosphorylation | LISTYPKSGTTWVSQ EEEECCCCCCCHHHH | 36.55 | - | |
69 | Ubiquitination | YQGGDLEKCHRAPIF HHCCCHHHHCCCCEE | 42.51 | - | |
85 | Ubiquitination | RVPFLEFKAPGIPSG ECCEEEEECCCCCCC | 44.27 | 21906983 | |
91 | Phosphorylation | FKAPGIPSGMETLKD EECCCCCCCHHHHCC | 49.18 | 28857561 | |
95 | Phosphorylation | GIPSGMETLKDTPAP CCCCCHHHHCCCCCC | 30.16 | 28857561 | |
97 | Ubiquitination | PSGMETLKDTPAPRL CCCHHHHCCCCCCHH | 67.96 | 21906983 | |
99 | Phosphorylation | GMETLKDTPAPRLLK CHHHHCCCCCCHHHH | 21.55 | 28857561 | |
106 | Acetylation | TPAPRLLKTHLPLAL CCCCHHHHHCCCHHH | 38.19 | 19608861 | |
106 | Ubiquitination | TPAPRLLKTHLPLAL CCCCHHHHHCCCHHH | 38.19 | 21890473 | |
107 | Phosphorylation | PAPRLLKTHLPLALL CCCHHHHHCCCHHHC | 28.72 | - | |
117 | Phosphorylation | PLALLPQTLLDQKVK CHHHCCHHHHCCCCE | 27.61 | - | |
119 | Ubiquitination | ALLPQTLLDQKVKVV HHCCHHHHCCCCEEE | 8.12 | 22817900 | |
122 | Ubiquitination | PQTLLDQKVKVVYVA CHHHHCCCCEEEEEE | 43.63 | 2190698 | |
123 | Ubiquitination | QTLLDQKVKVVYVAR HHHHCCCCEEEEEEC | 4.77 | 22817900 | |
124 | Ubiquitination | TLLDQKVKVVYVARN HHHCCCCEEEEEECC | 32.78 | 33845483 | |
138 | Phosphorylation | NAKDVAVSYYHFYHM CCHHHHHHHHEHHHH | 15.38 | 28258704 | |
140 | Phosphorylation | KDVAVSYYHFYHMAK HHHHHHHHEHHHHCC | 4.30 | - | |
176 | Ubiquitination | YGSWYQHVQEWWELS CCHHHHHHHHHHHHH | 3.05 | 21890473 | |
188 | Ubiquitination | ELSRTHPVLYLFYED HHHCCCCEEHHCHHH | 4.21 | 21890473 | |
193 | Phosphorylation | HPVLYLFYEDMKENP CCEEHHCHHHHHHCH | 14.39 | 21253578 | |
197 | Ubiquitination | YLFYEDMKENPKREI HHCHHHHHHCHHHHH | 67.66 | 21890473 | |
201 | Ubiquitination | EDMKENPKREIQKIL HHHHHCHHHHHHHHH | 74.39 | 22817900 | |
205 | Ubiquitination | ENPKREIQKILEFVG HCHHHHHHHHHHHHH | 23.22 | 32015554 | |
213 | Ubiquitination | KILEFVGRSLPEETV HHHHHHHCCCCHHHH | 29.71 | 21890473 | |
230 | Acetylation | VVQHTSFKEMKKNPM EEECCCHHHHHCCCC | 57.58 | 10652617 | |
241 | Phosphorylation | KNPMTNYTTVPQEFM CCCCCCCCCCCHHHH | 24.32 | 29116813 | |
242 | Phosphorylation | NPMTNYTTVPQEFMD CCCCCCCCCCHHHHH | 21.59 | 29116813 | |
251 | Phosphorylation | PQEFMDHSISPFMRK CHHHHHCCCCHHHHC | 22.09 | 29116813 | |
253 | Phosphorylation | EFMDHSISPFMRKGM HHHHCCCCHHHHCCC | 18.33 | 25159151 | |
283 | Ubiquitination | FDADYAEKMAGCSLS CCHHHHHHHCCCCEE | 26.36 | 32015554 | |
288 | Ubiquitination | AEKMAGCSLSFRSEL HHHHCCCCEEECCCC | 26.57 | 22817900 | |
288 | Phosphorylation | AEKMAGCSLSFRSEL HHHHCCCCEEECCCC | 26.57 | 20873877 | |
290 | Phosphorylation | KMAGCSLSFRSEL-- HHCCCCEEECCCC-- | 11.43 | 20873877 | |
292 | Ubiquitination | AGCSLSFRSEL---- CCCCEEECCCC---- | 26.33 | 22817900 | |
293 | Phosphorylation | GCSLSFRSEL----- CCCEEECCCC----- | 41.04 | 26434776 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ST1A1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ST1A1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ST1A1_HUMAN !! |
loading...