| UniProt ID | ST1A4_HUMAN | |
|---|---|---|
| UniProt AC | P0DMN0 | |
| Protein Name | Sulfotransferase 1A4 | |
| Gene Name | SULT1A4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 295 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.. | |
| Protein Sequence | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 76 | Phosphorylation | KCNRAPIYVRVPFLE HCCCCCEEEECCEEE | - | ||
| 97 (in isoform 2) | Ubiquitination | - | - | ||
| 106 (in isoform 2) | Ubiquitination | - | - | ||
| 117 | Phosphorylation | PLALLPQTLLDQKVK CHHHCCHHHHCCCEE | - | ||
| 139 | Phosphorylation | PKDVAVSYYHFHRME HHHHEEEHEEHHHHH | 20068231 | ||
| 140 | Phosphorylation | KDVAVSYYHFHRMEK HHHEEEHEEHHHHHH | 20068231 | ||
| 193 | Phosphorylation | HPVLYLFYEDMKENP CCEEHHCHHHHHHCH | 21253578 | ||
| 228 | Phosphorylation | DFMVQHTSFKEMKKN HHHHHCCCHHHHHCC | 24275569 | ||
| 251 | Phosphorylation | PQELMDHSISPFMRK CHHHHCCCCCHHHHC | 20068231 | ||
| 253 | Phosphorylation | ELMDHSISPFMRKGM HHHCCCCCHHHHCCC | 20068231 | ||
| 288 | Phosphorylation | AEKMAGCSLSFRSEL HHHHCCCCEEECCCC | 20873877 | ||
| 290 | Phosphorylation | KMAGCSLSFRSEL-- HHCCCCEEECCCC-- | 20873877 | ||
| 293 | Phosphorylation | GCSLSFRSEL----- CCCEEECCCC----- | 26434776 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ST1A4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ST1A4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ST1A4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| NIF3L_HUMAN | NIF3L1 | physical | 25416956 | |
| KHDR2_HUMAN | KHDRBS2 | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
