UniProt ID | ST1A3_HUMAN | |
---|---|---|
UniProt AC | P0DMM9 | |
Protein Name | Sulfotransferase 1A3 | |
Gene Name | SULT1A3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 295 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.. | |
Protein Sequence | MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Ubiquitination | RPPLEYVKGVPLIKY CCCCHHHCCCHHHHH | 53.97 | - | |
16 | Ubiquitination | RPPLEYVKGVPLIKY CCCCHHHCCCHHHHH | 53.97 | - | |
76 | Phosphorylation | KCNRAPIYVRVPFLE HCCCCCEEEECCEEE | 4.91 | - | |
97 | Ubiquitination | PSGLETLKDTPPPRL CCCHHHCCCCCCCCH | 67.96 | 21906983 | |
97 | Ubiquitination | PSGLETLKDTPPPRL CCCHHHCCCCCCCCH | 67.96 | - | |
106 | Ubiquitination | TPPPRLIKSHLPLAL CCCCCHHHHCCCHHH | 36.09 | - | |
106 | Acetylation | TPPPRLIKSHLPLAL CCCCCHHHHCCCHHH | 36.09 | 69735 | |
117 | Phosphorylation | PLALLPQTLLDQKVK CHHHCCHHHHCCCEE | 27.61 | - | |
122 | Ubiquitination | PQTLLDQKVKVVYVA CHHHHCCCEEEEEEE | 43.63 | - | |
124 | Ubiquitination | TLLDQKVKVVYVARN HHHCCCEEEEEEECC | 32.78 | - | |
139 | Phosphorylation | PKDVAVSYYHFHRME HHHHEEEHEEHHHHH | 8.38 | 20068231 | |
140 | Phosphorylation | KDVAVSYYHFHRMEK HHHEEEHEEHHHHHH | 7.18 | 20068231 | |
193 | Phosphorylation | HPVLYLFYEDMKENP CCEEHHCHHHHHHCH | 14.39 | 21253578 | |
228 | Phosphorylation | DFMVQHTSFKEMKKN HHHHHCCCHHHHHCC | 32.00 | 24275569 | |
251 | Phosphorylation | PQELMDHSISPFMRK CHHHHCCCCCHHHHC | 22.09 | 20068231 | |
253 | Phosphorylation | ELMDHSISPFMRKGM HHHCCCCCHHHHCCC | 18.33 | 20068231 | |
283 | Ubiquitination | FDADYAEKMAGCSLS CCHHHHHHHCCCCEE | 26.36 | - | |
288 | Phosphorylation | AEKMAGCSLSFRSEL HHHHCCCCEEECCCC | 26.57 | 20873877 | |
290 | Phosphorylation | KMAGCSLSFRSEL-- HHCCCCEEECCCC-- | 11.43 | 20873877 | |
293 | Phosphorylation | GCSLSFRSEL----- CCCEEECCCC----- | 41.04 | 26434776 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ST1A3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ST1A3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ST1A3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
NIF3L_HUMAN | NIF3L1 | physical | 25416956 | |
KHDR2_HUMAN | KHDRBS2 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...