UniProt ID | NACA2_HUMAN | |
---|---|---|
UniProt AC | Q9H009 | |
Protein Name | Nascent polypeptide-associated complex subunit alpha-2 | |
Gene Name | NACA2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 215 | |
Subcellular Localization | Cytoplasm. Nucleus. | |
Protein Description | Prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). Binds to nascent polypeptide chains as they emerge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. Also reduces the inherent affinity of ribosomes for protein translocation sites in the ER membrane (M sites) (By similarity).. | |
Protein Sequence | MPGEATETVPATEQELPQSQAETGSGTASDSGESVPGIEEQDSTQTTTQKAWLVAAAEIDEEPVGKAKQSRSEKRARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAYIVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKDVKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
43 | Phosphorylation | PGIEEQDSTQTTTQK CCCCCCCCCCHHHHH | 23.31 | - | |
68 | Ubiquitination | EEPVGKAKQSRSEKR CCCCCCHHHCHHHHH | 52.90 | - | |
82 | Ubiquitination | RARKAMSKLGLLQVT HHHHHHHHHCCCHHC | 33.23 | - | |
89 | Phosphorylation | KLGLLQVTGVTRVTI HHCCCHHCCCCEEEE | 16.99 | 20068231 | |
92 | Phosphorylation | LLQVTGVTRVTIWKS CCHHCCCCEEEEECC | 22.29 | 20068231 | |
100 | Ubiquitination | RVTIWKSKNILFVIT EEEEECCCCEEEEEE | 44.26 | 21906983 | |
108 | Acetylation | NILFVITKLDVYKSP CEEEEEEEEEECCCC | 31.40 | 26051181 | |
108 | Ubiquitination | NILFVITKLDVYKSP CEEEEEEEEEECCCC | 31.40 | 21906983 | |
113 | Ubiquitination | ITKLDVYKSPASDAY EEEEEECCCCCCCCE | 50.22 | - | |
127 | Ubiquitination | YIVFGEAKIQDLSQQ EEEEEEHHHHHHHHH | 36.28 | - | |
132 | Phosphorylation | EAKIQDLSQQAQLAA EHHHHHHHHHHHHHH | 28.65 | - | |
142 | Ubiquitination | AQLAAAEKFRVQGEA HHHHHHHHHHCCCEE | 33.47 | 21906983 | |
142 | Acetylation | AQLAAAEKFRVQGEA HHHHHHHHHHCCCEE | 33.47 | - | |
157 | Phosphorylation | VGNIQENTQTPTVQE ECCCCCCCCCCCCCC | 32.82 | 26657352 | |
159 | Phosphorylation | NIQENTQTPTVQEES CCCCCCCCCCCCCHH | 20.91 | 15005626 | |
161 | Phosphorylation | QENTQTPTVQEESEE CCCCCCCCCCCHHHH | 37.90 | 25159151 | |
166 | Phosphorylation | TPTVQEESEEEEVDE CCCCCCHHHHHCCCC | 49.94 | 25159151 | |
174 | Phosphorylation | EEEEVDETGVEVKDV HHHCCCCCCCCHHHH | 41.90 | 22496350 | |
186 | Phosphorylation | KDVKLVMSQANVSRA HHHEEEEECCCHHHH | 20.75 | - | |
191 | Phosphorylation | VMSQANVSRAKAVRA EEECCCHHHHHHHHH | 26.74 | 20068231 | |
200 | Ubiquitination | AKAVRALKNNSNDIV HHHHHHHHCCCHHHH | 53.77 | - | |
203 | Phosphorylation | VRALKNNSNDIVNAI HHHHHCCCHHHHHHH | 45.32 | 28112733 | |
214 | Phosphorylation | VNAIMELTV------ HHHHHHHCC------ | 15.74 | 28464451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NACA2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NACA2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NACA2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RL32_HUMAN | RPL32 | physical | 22939629 | |
RS13_HUMAN | RPS13 | physical | 22939629 | |
RS21_HUMAN | RPS21 | physical | 22939629 | |
TERA_HUMAN | VCP | physical | 22939629 | |
RL23_HUMAN | RPL23 | physical | 22939629 | |
RS25_HUMAN | RPS25 | physical | 22939629 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-214, AND MASSSPECTROMETRY. |