| UniProt ID | GNB1L_HUMAN | |
|---|---|---|
| UniProt AC | Q9BYB4 | |
| Protein Name | Guanine nucleotide-binding protein subunit beta-like protein 1 | |
| Gene Name | GNB1L | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 327 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVHIWSLQTRRAVTTLDGHGGQCVTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVLWDVSEQKVCSRIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDWQQALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIRVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MTAPCPPPP ------CCCCCCCCC | 39.03 | 24719451 | |
| 2 | Acetylation | ------MTAPCPPPP ------CCCCCCCCC | 39.03 | 19413330 | |
| 19 | Phosphorylation | PQFVLRGTQSPVHAL CCCEEECCCCCCHHH | 21.31 | 20873877 | |
| 21 | Phosphorylation | FVLRGTQSPVHALHF CEEECCCCCCHHHHC | 28.82 | 20873877 | |
| 91 (in isoform 2) | Ubiquitination | - | 41.25 | 21906983 | |
| 91 (in isoform 1) | Ubiquitination | - | 41.25 | 21906983 | |
| 91 | Ubiquitination | LSQGRDLKLCLWDLA HHCCCCHHHHHHHHH | 41.25 | 22817900 | |
| 119 | Phosphorylation | SVGFCRSSILAGGQP HCCCCHHHHHCCCCC | 11.41 | 21712546 | |
| 147 | Phosphorylation | VQILEMPSKTSVCAL EEEEECCCCCCEEEE | 47.45 | 30108239 | |
| 148 | Ubiquitination | QILEMPSKTSVCALK EEEECCCCCCEEEEC | 38.66 | 21963094 | |
| 155 | Ubiquitination | KTSVCALKPKADAKL CCCEEEECCCHHCCC | 26.41 | 29967540 | |
| 157 | Ubiquitination | SVCALKPKADAKLGM CEEEECCCHHCCCCC | 58.26 | 29967540 | |
| 161 | Ubiquitination | LKPKADAKLGMPMCL ECCCHHCCCCCCHHH | 46.23 | - | |
| 218 | Phosphorylation | VMDLDFDSQKARGIS CCCCCCCCCHHCCCC | 33.31 | - | |
| 220 | Ubiquitination | DLDFDSQKARGISGS CCCCCCCHHCCCCCC | 43.96 | 21963094 | |
| 220 | Acetylation | DLDFDSQKARGISGS CCCCCCCHHCCCCCC | 43.96 | 25953088 | |
| 266 | Ubiquitination | VTIRPDRKILATAGW EEECCCCEEEEECCC | 49.83 | - | |
| 266 | Malonylation | VTIRPDRKILATAGW EEECCCCEEEEECCC | 49.83 | 26320211 | |
| 284 | Phosphorylation | IRVFHWRTMQPLAVL EEEEECCCCCHHHHH | 18.24 | 22210691 | |
| 313 | Phosphorylation | DGLLAAGSKDQRISL CHHHHCCCCCCEEEE | 28.47 | 22210691 | |
| 324 | Phosphorylation | RISLWSLYPRA---- EEEEEEECCCC---- | 5.78 | 22210691 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GNB1L_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GNB1L_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GNB1L_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TCPH_HUMAN | CCT7 | physical | 28514442 | |
| TCPG_HUMAN | CCT3 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...