UniProt ID | PTH_HUMAN | |
---|---|---|
UniProt AC | Q86Y79 | |
Protein Name | Probable peptidyl-tRNA hydrolase | |
Gene Name | PTRH1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 214 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRLGVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVHDELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATDLILDHIRERSQGPSLGP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
133 | Malonylation | PLGRLALKLGGSARG HHHHHHHHHCCCCCC | 39.21 | 26320211 | |
133 | Acetylation | PLGRLALKLGGSARG HHHHHHHHHCCCCCC | 39.21 | 25953088 | |
196 | Phosphorylation | PLLLDRATDLILDHI HHHHHHHHHHHHHHH | 32.03 | 24825855 | |
207 | Phosphorylation | LDHIRERSQGPSLGP HHHHHHHHCCCCCCC | 34.43 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PTH_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PTH_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PTH_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FAM9B_HUMAN | FAM9B | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...