| UniProt ID | TX1B3_HUMAN | |
|---|---|---|
| UniProt AC | O14907 | |
| Protein Name | Tax1-binding protein 3 | |
| Gene Name | TAX1BP3 {ECO:0000312|HGNC:HGNC:30684} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 124 | |
| Subcellular Localization |
Cytoplasm. Nucleus. Cell membrane Peripheral membrane protein Cytoplasmic side. Recruited to the cell membrane by interaction with membrane proteins. |
|
| Protein Description | May regulate a number of protein-protein interactions by competing for PDZ domain binding sites. Binds CTNNB1 and may thereby act as an inhibitor of the Wnt signaling pathway. Competes with LIN7A for KCNJ4 binding, and thereby promotes KCNJ4 internalization. May play a role in the Rho signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6.. | |
| Protein Sequence | MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSYIPGQPV ------CCCCCCCCE | 31.59 | 30576142 | |
| 2 | Acetylation | ------MSYIPGQPV ------CCCCCCCCE | 31.59 | 22223895 | |
| 3 | Phosphorylation | -----MSYIPGQPVT -----CCCCCCCCEE | 15.16 | 25394399 | |
| 10 | Phosphorylation | YIPGQPVTAVVQRVE CCCCCCEEEEEEEEE | 22.03 | 24043423 | |
| 32 | Phosphorylation | ENLILGFSIGGGIDQ CCEEEEEEECCCCCC | 20.65 | 28348404 | |
| 42 | Phosphorylation | GGIDQDPSQNPFSED CCCCCCCCCCCCCCC | 51.37 | 28348404 | |
| 53 | 2-Hydroxyisobutyrylation | FSEDKTDKGIYVTRV CCCCCCCCCEEEEEE | 53.06 | - | |
| 53 | Ubiquitination | FSEDKTDKGIYVTRV CCCCCCCCCEEEEEE | 53.06 | - | |
| 56 | Phosphorylation | DKTDKGIYVTRVSEG CCCCCCEEEEEECCC | 12.39 | 30576142 | |
| 58 | Phosphorylation | TDKGIYVTRVSEGGP CCCCEEEEEECCCCC | 14.37 | 22617229 | |
| 61 | Phosphorylation | GIYVTRVSEGGPAEI CEEEEEECCCCCCEE | 27.51 | 30266825 | |
| 86 | Phosphorylation | QVNGWDMTMVTHDQA EECCCEEEEECHHHH | 13.15 | 26552605 | |
| 89 | Phosphorylation | GWDMTMVTHDQARKR CCEEEEECHHHHHHH | 14.65 | 26552605 | |
| 110 | Phosphorylation | EVVRLLVTRQSLQKA HHHHHHHHHHHHHHH | 23.98 | 22496350 | |
| 113 | Phosphorylation | RLLVTRQSLQKAVQQ HHHHHHHHHHHHHHH | 29.49 | 29978859 | |
| 116 | Ubiquitination | VTRQSLQKAVQQSML HHHHHHHHHHHHHHC | 56.68 | - | |
| 121 | Phosphorylation | LQKAVQQSMLS---- HHHHHHHHHCC---- | 12.47 | 20068231 | |
| 124 | Phosphorylation | AVQQSMLS------- HHHHHHCC------- | 29.54 | 22496350 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TX1B3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TX1B3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TX1B3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CTNB1_HUMAN | CTNNB1 | physical | 18835279 | |
| CK5P3_HUMAN | CDK5RAP3 | physical | 23028987 | |
| UB2D2_HUMAN | UBE2D2 | physical | 22939629 | |
| VAMP2_HUMAN | VAMP2 | physical | 22939629 | |
| DTX1_HUMAN | DTX1 | physical | 23395680 | |
| STAU1_HUMAN | STAU1 | physical | 23395680 | |
| RN183_HUMAN | RNF183 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-61, AND MASSSPECTROMETRY. | |