UniProt ID | VAMP2_HUMAN | |
---|---|---|
UniProt AC | P63027 | |
Protein Name | Vesicle-associated membrane protein 2 | |
Gene Name | VAMP2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 116 | |
Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Single-pass type IV membrane protein. Cell junction, synapse, synaptosome. Cell membrane . Neuronal synaptic vesicles. Colocalizes with PRKCZ and WDFY2 in intracellular vesicles (PubM |
|
Protein Description | Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.. | |
Protein Sequence | MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSATAATAP ------CCCCCCCCC | 34.03 | 29255136 | |
2 | Acetylation | ------MSATAATAP ------CCCCCCCCC | 34.03 | 19413330 | |
4 | Phosphorylation | ----MSATAATAPPA ----CCCCCCCCCCC | 14.98 | 29255136 | |
7 | Phosphorylation | -MSATAATAPPAAPA -CCCCCCCCCCCCCC | 36.91 | 29255136 | |
27 | Phosphorylation | PAPPPNLTSNRRLQQ CCCCCCCCCCHHHHH | 30.51 | 29255136 | |
28 | Phosphorylation | APPPNLTSNRRLQQT CCCCCCCCCHHHHHH | 31.35 | 29255136 | |
46 | Sulfoxidation | VDEVVDIMRVNVDKV HHHHHHHHHCCHHHH | 3.20 | 21406390 | |
52 | Ubiquitination | IMRVNVDKVLERDQK HHHCCHHHHHHHHHH | 44.42 | 21890473 | |
59 | Ubiquitination | KVLERDQKLSELDDR HHHHHHHHHHHHHHH | 59.26 | 21906983 | |
61 | Phosphorylation | LERDQKLSELDDRAD HHHHHHHHHHHHHHH | 43.05 | 23401153 | |
66 | Methylation | KLSELDDRADALQAG HHHHHHHHHHHHHHH | 33.75 | - | |
75 | Phosphorylation | DALQAGASQFETSAA HHHHHHHHHHHHHHH | 34.19 | 23401153 | |
79 | Phosphorylation | AGASQFETSAAKLKR HHHHHHHHHHHHHHH | 25.59 | 30266825 | |
80 | Phosphorylation | GASQFETSAAKLKRK HHHHHHHHHHHHHHH | 21.02 | 19664994 | |
83 | Ubiquitination | QFETSAAKLKRKYWW HHHHHHHHHHHHHHH | 55.01 | 21890473 | |
83 | Ubiquitination | QFETSAAKLKRKYWW HHHHHHHHHHHHHHH | 55.01 | 21890473 | |
85 | Ubiquitination | ETSAAKLKRKYWWKN HHHHHHHHHHHHHHH | 46.25 | 21890473 | |
85 | Ubiquitination | ETSAAKLKRKYWWKN HHHHHHHHHHHHHHH | 46.25 | 21890473 | |
91 | Ubiquitination | LKRKYWWKNLKMMII HHHHHHHHHHHHHHH | 37.95 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
61 | S | Phosphorylation | Kinase | CAMK2-FAMILY | - | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VAMP2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VAMP2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
STXB3_HUMAN | STXBP3 | physical | 12832401 | |
STX4_HUMAN | STX4 | physical | 12517971 | |
STX11_HUMAN | STX11 | physical | 10036234 | |
VAPB_HUMAN | VAPB | physical | 9920726 | |
STX4_HUMAN | STX4 | physical | 8760387 | |
BAP31_HUMAN | BCAP31 | physical | 9396746 | |
STX1A_HUMAN | STX1A | physical | 10100611 | |
STX1A_HUMAN | STX1A | physical | 9030619 | |
SNP25_HUMAN | SNAP25 | physical | 9030619 | |
SNP23_HUMAN | SNAP23 | physical | 10713150 | |
VAMP3_HUMAN | VAMP3 | physical | 12130530 | |
VAMP8_HUMAN | VAMP8 | physical | 12130530 | |
SYT1_HUMAN | SYT1 | physical | 22890573 | |
SNP25_HUMAN | SNAP25 | physical | 22890573 | |
VAPA_HUMAN | VAPA | physical | 22939629 | |
VPP1_HUMAN | ATP6V0A1 | physical | 22939629 | |
ZNT5_HUMAN | SLC30A5 | physical | 22939629 | |
SNP29_HUMAN | SNAP29 | physical | 25416956 | |
EXOC3_HUMAN | EXOC3 | physical | 23897890 | |
STX7_HUMAN | STX7 | physical | 26344197 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00042 | Botulinum Toxin Type B |
loading...