VAMP2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VAMP2_HUMAN
• UniProt AC: P63027
• Protein Name: Vesicle-associated membrane protein 2
• Gene Name: VAMP2
• Organism: Homo sapiens (Human).
• Sequence Length: 116
• Subcellular Localization: Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell junction, synapse, synaptosome. Cell membrane . Neuronal synaptic vesicles. Colocalizes with PRKCZ and WDFY2 in intracellular vesicles (PubM
• Protein Description: Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1..
• Protein Sequence: MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSATAATAP ------CCCCCCCCC	34.03	29255136
2	Acetylation	------MSATAATAP ------CCCCCCCCC	34.03	19413330
4	Phosphorylation	----MSATAATAPPA ----CCCCCCCCCCC	14.98	29255136
7	Phosphorylation	-MSATAATAPPAAPA -CCCCCCCCCCCCCC	36.91	29255136
27	Phosphorylation	PAPPPNLTSNRRLQQ CCCCCCCCCCHHHHH	30.51	29255136
28	Phosphorylation	APPPNLTSNRRLQQT CCCCCCCCCHHHHHH	31.35	29255136
46	Sulfoxidation	VDEVVDIMRVNVDKV HHHHHHHHHCCHHHH	3.20	21406390
52	Ubiquitination	IMRVNVDKVLERDQK HHHCCHHHHHHHHHH	44.42	21890473
59	Ubiquitination	KVLERDQKLSELDDR HHHHHHHHHHHHHHH	59.26	21906983
61	Phosphorylation	LERDQKLSELDDRAD HHHHHHHHHHHHHHH	43.05	23401153
66	Methylation	KLSELDDRADALQAG HHHHHHHHHHHHHHH	33.75	-
75	Phosphorylation	DALQAGASQFETSAA HHHHHHHHHHHHHHH	34.19	23401153
79	Phosphorylation	AGASQFETSAAKLKR HHHHHHHHHHHHHHH	25.59	30266825
80	Phosphorylation	GASQFETSAAKLKRK HHHHHHHHHHHHHHH	21.02	19664994
83	Ubiquitination	QFETSAAKLKRKYWW HHHHHHHHHHHHHHH	55.01	21890473
83	Ubiquitination	QFETSAAKLKRKYWW HHHHHHHHHHHHHHH	55.01	21890473
85	Ubiquitination	ETSAAKLKRKYWWKN HHHHHHHHHHHHHHH	46.25	21890473
85	Ubiquitination	ETSAAKLKRKYWWKN HHHHHHHHHHHHHHH	46.25	21890473
91	Ubiquitination	LKRKYWWKNLKMMII HHHHHHHHHHHHHHH	37.95	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
61	S	Phosphorylation	Kinase	CAMK2-FAMILY	-	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VAMP2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VAMP2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
STXB3_HUMAN	STXBP3	physical	12832401
STX4_HUMAN	STX4	physical	12517971
STX11_HUMAN	STX11	physical	10036234
VAPB_HUMAN	VAPB	physical	9920726
STX4_HUMAN	STX4	physical	8760387
BAP31_HUMAN	BCAP31	physical	9396746
STX1A_HUMAN	STX1A	physical	10100611
STX1A_HUMAN	STX1A	physical	9030619
SNP25_HUMAN	SNAP25	physical	9030619
SNP23_HUMAN	SNAP23	physical	10713150
VAMP3_HUMAN	VAMP3	physical	12130530
VAMP8_HUMAN	VAMP8	physical	12130530
SYT1_HUMAN	SYT1	physical	22890573
SNP25_HUMAN	SNAP25	physical	22890573
VAPA_HUMAN	VAPA	physical	22939629
VPP1_HUMAN	ATP6V0A1	physical	22939629
ZNT5_HUMAN	SLC30A5	physical	22939629
SNP29_HUMAN	SNAP29	physical	25416956
EXOC3_HUMAN	EXOC3	physical	23897890
STX7_HUMAN	STX7	physical	26344197

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• DB00042: Botulinum Toxin Type B