| UniProt ID | VAPA_HUMAN | |
|---|---|---|
| UniProt AC | Q9P0L0 | |
| Protein Name | Vesicle-associated membrane protein-associated protein A | |
| Gene Name | VAPA | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 249 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type IV membrane protein . Cell membrane Single-pass type IV membrane protein . Cell junction, tight junction . Nucleus membrane . Present in the plasma membrane and in intracellular vesicles, together w |
|
| Protein Description | Binds to OSBPL3, which mediates recruitment of VAPA to plasma membrane sites. [PubMed: 25447204 The ORP3-VAPA complex stimulates RRAS signaling which in turn attenuates integrin beta-1 (ITGB1) activation at the cell surface] | |
| Protein Sequence | MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MASASGAMA ------CCCCCCCCC | 17.50 | 25944712 | |
| 3 | Phosphorylation | -----MASASGAMAK -----CCCCCCCCCC | 22.97 | 29255136 | |
| 3 (in isoform 2) | Phosphorylation | - | 22.97 | 24719451 | |
| 5 | Phosphorylation | ---MASASGAMAKHE ---CCCCCCCCCCCC | 25.29 | 29255136 | |
| 5 (in isoform 2) | Phosphorylation | - | 25.29 | 27251275 | |
| 24 | Acetylation | LDPPTDLKFKGPFTD ECCCCCCCCCCCCCC | 48.08 | 25953088 | |
| 24 | Ubiquitination | LDPPTDLKFKGPFTD ECCCCCCCCCCCCCC | 48.08 | 23000965 | |
| 24 (in isoform 2) | Malonylation | - | 48.08 | 26320211 | |
| 24 | Malonylation | LDPPTDLKFKGPFTD ECCCCCCCCCCCCCC | 48.08 | 26320211 | |
| 25 | Ubiquitination | DPPTDLKFKGPFTDV CCCCCCCCCCCCCCE | 16.77 | 23000965 | |
| 26 | Ubiquitination | PPTDLKFKGPFTDVV CCCCCCCCCCCCCEE | 65.18 | 23000965 | |
| 26 (in isoform 2) | Ubiquitination | - | 65.18 | - | |
| 26 (in isoform 2) | Malonylation | - | 65.18 | 26320211 | |
| 26 | Acetylation | PPTDLKFKGPFTDVV CCCCCCCCCCCCCEE | 65.18 | 26051181 | |
| 26 | Malonylation | PPTDLKFKGPFTDVV CCCCCCCCCCCCCEE | 65.18 | 26320211 | |
| 30 | Phosphorylation | LKFKGPFTDVVTTNL CCCCCCCCCEEEECC | 30.90 | - | |
| 34 | Phosphorylation | GPFTDVVTTNLKLRN CCCCCEEEECCEECC | 15.15 | 28555341 | |
| 38 | Ubiquitination | DVVTTNLKLRNPSDR CEEEECCEECCCCCC | 47.69 | 23000965 | |
| 38 | Acetylation | DVVTTNLKLRNPSDR CEEEECCEECCCCCC | 47.69 | 25953088 | |
| 50 | Methylation | SDRKVCFKVKTTAPR CCCCEEEEEECCCCC | 37.38 | - | |
| 50 | Acetylation | SDRKVCFKVKTTAPR CCCCEEEEEECCCCC | 37.38 | 25953088 | |
| 59 | Phosphorylation | KTTAPRRYCVRPNSG ECCCCCEEEECCCCC | 9.14 | 28122231 | |
| 65 | Phosphorylation | RYCVRPNSGIIDPGS EEEECCCCCCCCCCC | 33.77 | 28102081 | |
| 65 | O-linked_Glycosylation | RYCVRPNSGIIDPGS EEEECCCCCCCCCCC | 33.77 | 32870666 | |
| 72 | Phosphorylation | SGIIDPGSTVTVSVM CCCCCCCCEEEEEEE | 25.70 | 28122231 | |
| 73 | O-linked_Glycosylation | GIIDPGSTVTVSVML CCCCCCCEEEEEEEE | 26.55 | 32870666 | |
| 73 | Phosphorylation | GIIDPGSTVTVSVML CCCCCCCEEEEEEEE | 26.55 | 28122231 | |
| 75 | Phosphorylation | IDPGSTVTVSVMLQP CCCCCEEEEEEEECC | 13.73 | 28122231 | |
| 77 | O-linked_Glycosylation | PGSTVTVSVMLQPFD CCCEEEEEEEECCCC | 7.76 | 32870666 | |
| 77 | Ubiquitination | PGSTVTVSVMLQPFD CCCEEEEEEEECCCC | 7.76 | 21963094 | |
| 85 | Phosphorylation | VMLQPFDYDPNEKSK EEECCCCCCCCCCCC | 33.41 | 22210691 | |
| 90 | Ubiquitination | FDYDPNEKSKHKFMV CCCCCCCCCCCEEEE | 72.02 | 21963094 | |
| 91 | Phosphorylation | DYDPNEKSKHKFMVQ CCCCCCCCCCEEEEE | 33.54 | 22210691 | |
| 92 | Ubiquitination | YDPNEKSKHKFMVQT CCCCCCCCCEEEEEE | 62.98 | - | |
| 94 | Acetylation | PNEKSKHKFMVQTIF CCCCCCCEEEEEEEE | 38.60 | 25953088 | |
| 106 | Phosphorylation | TIFAPPNTSDMEAVW EEECCCCCCHHHHHH | 31.70 | - | |
| 107 | Phosphorylation | IFAPPNTSDMEAVWK EECCCCCCHHHHHHH | 41.42 | - | |
| 117 | Acetylation | EAVWKEAKPDELMDS HHHHHHCCHHHHHCC | 54.84 | 26051181 | |
| 125 | Acetylation | PDELMDSKLRCVFEM HHHHHCCCCEEEEEC | 35.37 | 19608861 | |
| 125 | Ubiquitination | PDELMDSKLRCVFEM HHHHHCCCCEEEEEC | 35.37 | 32015554 | |
| 125 (in isoform 2) | Malonylation | - | 35.37 | 26320211 | |
| 125 | Malonylation | PDELMDSKLRCVFEM HHHHHCCCCEEEEEC | 35.37 | 26320211 | |
| 133 | Ubiquitination | LRCVFEMPNENDKLN CEEEEECCCCCCCCC | 37.47 | 21890473 | |
| 138 | Ubiquitination | EMPNENDKLNDMEPS ECCCCCCCCCCCCCC | 61.85 | 29967540 | |
| 138 | Acetylation | EMPNENDKLNDMEPS ECCCCCCCCCCCCCC | 61.85 | 25953088 | |
| 141 | Ubiquitination | NENDKLNDMEPSKAV CCCCCCCCCCCCCCC | 53.94 | 27667366 | |
| 142 (in isoform 2) | Phosphorylation | - | 8.75 | 22199227 | |
| 142 | Sulfoxidation | ENDKLNDMEPSKAVP CCCCCCCCCCCCCCC | 8.75 | 28465586 | |
| 145 | Phosphorylation | KLNDMEPSKAVPLNA CCCCCCCCCCCCCCC | 21.68 | 30266825 | |
| 146 | Ubiquitination | LNDMEPSKAVPLNAS CCCCCCCCCCCCCCC | 65.21 | 23000965 | |
| 149 (in isoform 2) | Phosphorylation | - | 25.42 | 27174698 | |
| 151 (in isoform 2) | Phosphorylation | - | 35.78 | 27174698 | |
| 152 (in isoform 2) | Phosphorylation | - | 26.28 | 27174698 | |
| 153 | Phosphorylation | KAVPLNASKQDGPMP CCCCCCCCCCCCCCC | 29.76 | 25159151 | |
| 154 | Ubiquitination | AVPLNASKQDGPMPK CCCCCCCCCCCCCCC | 50.42 | 33845483 | |
| 154 (in isoform 2) | Phosphorylation | - | 50.42 | 27174698 | |
| 154 | Malonylation | AVPLNASKQDGPMPK CCCCCCCCCCCCCCC | 50.42 | 26320211 | |
| 155 (in isoform 2) | Phosphorylation | - | 59.40 | 27174698 | |
| 159 (in isoform 2) | Phosphorylation | - | 9.01 | 27174698 | |
| 161 | Ubiquitination | KQDGPMPKPHSVSLN CCCCCCCCCCCCCCC | 49.46 | 24816145 | |
| 161 | Acetylation | KQDGPMPKPHSVSLN CCCCCCCCCCCCCCC | 49.46 | 26051181 | |
| 161 | Malonylation | KQDGPMPKPHSVSLN CCCCCCCCCCCCCCC | 49.46 | 26320211 | |
| 162 (in isoform 2) | Phosphorylation | - | 21.08 | 22199227 | |
| 164 | Phosphorylation | GPMPKPHSVSLNDTE CCCCCCCCCCCCHHH | 23.17 | 23401153 | |
| 165 (in isoform 2) | Phosphorylation | - | 7.39 | 22199227 | |
| 166 | Phosphorylation | MPKPHSVSLNDTETR CCCCCCCCCCHHHHH | 25.19 | 30266825 | |
| 166 (in isoform 2) | Phosphorylation | - | 25.19 | 22199227 | |
| 168 (in isoform 2) | Phosphorylation | - | 46.80 | 22199227 | |
| 170 | Phosphorylation | HSVSLNDTETRKLME CCCCCCHHHHHHHHH | 37.88 | 30266825 | |
| 172 | Phosphorylation | VSLNDTETRKLMEEC CCCCHHHHHHHHHHH | 34.89 | 29255136 | |
| 174 | Ubiquitination | LNDTETRKLMEECKR CCHHHHHHHHHHHHH | 60.65 | 24816145 | |
| 175 | Ubiquitination | NDTETRKLMEECKRL CHHHHHHHHHHHHHH | 4.75 | 24816145 | |
| 176 (in isoform 2) | Phosphorylation | - | 4.58 | 26434776 | |
| 178 | Ubiquitination | ETRKLMEECKRLQGE HHHHHHHHHHHHHHH | 31.23 | 23000965 | |
| 180 | Ubiquitination | RKLMEECKRLQGEMM HHHHHHHHHHHHHHH | 60.46 | 29967540 | |
| 180 | Acetylation | RKLMEECKRLQGEMM HHHHHHHHHHHHHHH | 60.46 | 25953088 | |
| 186 | Ubiquitination | CKRLQGEMMKLSEEN HHHHHHHHHHHHHHH | 3.52 | 27667366 | |
| 188 | Ubiquitination | RLQGEMMKLSEENRH HHHHHHHHHHHHHHH | 47.77 | 21906983 | |
| 188 | Acetylation | RLQGEMMKLSEENRH HHHHHHHHHHHHHHH | 47.77 | 25953088 | |
| 190 | Phosphorylation | QGEMMKLSEENRHLR HHHHHHHHHHHHHHH | 37.03 | 28555341 | |
| 191 | Ubiquitination | GEMMKLSEENRHLRD HHHHHHHHHHHHHHH | 70.50 | 23000965 | |
| 192 | Ubiquitination | EMMKLSEENRHLRDE HHHHHHHHHHHHHHH | 57.07 | 23000965 | |
| 197 | Methylation | SEENRHLRDEGLRLR HHHHHHHHHHCCHHH | 33.53 | 115919745 | |
| 198 (in isoform 2) | Phosphorylation | - | 61.75 | 29743597 | |
| 198 | Ubiquitination | EENRHLRDEGLRLRK HHHHHHHHHCCHHHH | 61.75 | 23000965 | |
| 199 | Ubiquitination | ENRHLRDEGLRLRKV HHHHHHHHCCHHHHE | 54.41 | 27667366 | |
| 199 (in isoform 2) | Malonylation | - | 54.41 | 26320211 | |
| 202 | Methylation | HLRDEGLRLRKVAHS HHHHHCCHHHHEECC | 43.22 | 115919749 | |
| 205 | Ubiquitination | DEGLRLRKVAHSDKP HHCCHHHHEECCCCC | 48.65 | 23000965 | |
| 206 | Ubiquitination | EGLRLRKVAHSDKPG HCCHHHHEECCCCCC | 4.72 | 24816145 | |
| 206 (in isoform 2) | Malonylation | - | 4.72 | 26320211 | |
| 209 | Phosphorylation | RLRKVAHSDKPGSTS HHHHEECCCCCCCCC | 37.28 | 23927012 | |
| 209 (in isoform 2) | Phosphorylation | - | 37.28 | 24719451 | |
| 211 | Ubiquitination | RKVAHSDKPGSTSTA HHEECCCCCCCCCCH | 55.05 | 23000965 | |
| 211 (in isoform 2) | Phosphorylation | - | 55.05 | 24719451 | |
| 211 | Acetylation | RKVAHSDKPGSTSTA HHEECCCCCCCCCCH | 55.05 | 23236377 | |
| 214 | Phosphorylation | AHSDKPGSTSTASFR ECCCCCCCCCCHHHH | 27.93 | 29255136 | |
| 215 | Phosphorylation | HSDKPGSTSTASFRD CCCCCCCCCCHHHHC | 35.69 | 30266825 | |
| 215 (in isoform 2) | Phosphorylation | - | 35.69 | 24719451 | |
| 216 | Phosphorylation | SDKPGSTSTASFRDN CCCCCCCCCHHHHCC | 24.55 | 30266825 | |
| 217 | Phosphorylation | DKPGSTSTASFRDNV CCCCCCCCHHHHCCC | 26.81 | 30266825 | |
| 219 | Phosphorylation | PGSTSTASFRDNVTS CCCCCCHHHHCCCCC | 22.39 | 30266825 | |
| 219 | Ubiquitination | PGSTSTASFRDNVTS CCCCCCHHHHCCCCC | 22.39 | 24816145 | |
| 220 | Ubiquitination | GSTSTASFRDNVTSP CCCCCHHHHCCCCCC | 12.03 | 24816145 | |
| 225 | Ubiquitination | ASFRDNVTSPLPSLL HHHHCCCCCCHHHHH | 30.77 | 29967540 | |
| 233 | Ubiquitination | SPLPSLLVVIAAIFI CCHHHHHHHHHHHHH | 3.38 | 33845483 | |
| 233 (in isoform 2) | Ubiquitination | - | 3.38 | - | |
| 237 | Ubiquitination | SLLVVIAAIFIGFFL HHHHHHHHHHHHHHH | 6.01 | 23000965 | |
| 243 | Ubiquitination | AAIFIGFFLGKFIL- HHHHHHHHHHHHCC- | 8.08 | 23000965 | |
| 250 | Ubiquitination | FLGKFIL-------- HHHHHCC-------- | 23000965 | ||
| 256 | Ubiquitination | L-------------- C-------------- | 23000965 | ||
| 259 (in isoform 2) | Phosphorylation | - | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VAPA_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VAPA_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VAPA_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. | |
| "Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-125, AND MASS SPECTROMETRY. | |
