UniProt ID | MMGT1_HUMAN | |
---|---|---|
UniProt AC | Q8N4V1 | |
Protein Name | Membrane magnesium transporter 1 | |
Gene Name | MMGT1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 131 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Golgi apparatus membrane Multi-pass membrane protein . Early endosome membrane Multi-pass membrane protein . |
|
Protein Description | Mediates Mg(2+) transport.. | |
Protein Sequence | MAPSLWKGLVGIGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
77 | Malonylation | MDATSELKNKTFDTL CCCCHHHCCCCHHHH | 52.96 | 26320211 | |
79 | Acetylation | ATSELKNKTFDTLRN CCHHHCCCCHHHHHC | 49.32 | 26051181 | |
122 (in isoform 1) | Ubiquitination | - | 46.11 | 21890473 | |
187 (in isoform 2) | Ubiquitination | - | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MMGT1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MMGT1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MMGT1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...