UniProt ID | EMC6_HUMAN | |
---|---|---|
UniProt AC | Q9BV81 | |
Protein Name | ER membrane protein complex subunit 6 | |
Gene Name | EMC6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 110 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAAVVAKRE ------CCCHHCCCC | 14.68 | 22814378 | |
7 | Ubiquitination | -MAAVVAKREGPPFI -CCCHHCCCCCCCCC | 39.10 | 33845483 | |
7 | 2-Hydroxyisobutyrylation | -MAAVVAKREGPPFI -CCCHHCCCCCCCCC | 39.10 | - | |
15 | Phosphorylation | REGPPFISEAAVRGN CCCCCCCCHHHHCCC | 22.89 | - | |
50 | Phosphorylation | ILGLTGLYGFIFYLL HHHHHHHHHHHHHHH | 16.01 | 24114839 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EMC6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EMC6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EMC6_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of EMC6_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...