UniProt ID | NDUAC_HUMAN | |
---|---|---|
UniProt AC | Q9UI09 | |
Protein Name | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 | |
Gene Name | NDUFA12 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 145 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Matrix side . |
|
Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
Protein Sequence | MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLTARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPPSTPYK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MELVQVLK -------CHHHHHHH | 8.96 | 22814378 | |
8 | Ubiquitination | MELVQVLKRGLQQIT CHHHHHHHHHHHHHH | 45.63 | 23000965 | |
8 | 2-Hydroxyisobutyrylation | MELVQVLKRGLQQIT CHHHHHHHHHHHHHH | 45.63 | - | |
34 | Acetylation | FFRTNDAKVGTLVGE EEECCCCCEEEEEEE | 44.02 | 27452117 | |
43 | Acetylation | GTLVGEDKYGNKYYE EEEEEECCCCCEEEE | 51.24 | 25825284 | |
43 | Ubiquitination | GTLVGEDKYGNKYYE EEEEEECCCCCEEEE | 51.24 | 33845483 | |
43 | Malonylation | GTLVGEDKYGNKYYE EEEEEECCCCCEEEE | 51.24 | 26320211 | |
47 | Acetylation | GEDKYGNKYYEDNKQ EECCCCCEEEECCCE | 44.86 | 25038526 | |
48 | Nitrated tyrosine | EDKYGNKYYEDNKQF ECCCCCEEEECCCEE | 18.98 | - | |
48 | Nitration | EDKYGNKYYEDNKQF ECCCCCEEEECCCEE | 18.98 | 12857734 | |
49 | Nitrated tyrosine | DKYGNKYYEDNKQFF CCCCCEEEECCCEEE | 20.58 | - | |
49 | Nitration | DKYGNKYYEDNKQFF CCCCCEEEECCCEEE | 20.58 | 12857734 | |
53 | Acetylation | NKYYEDNKQFFGRHR CEEEECCCEEECCCC | 61.88 | 25038526 | |
101 | Acetylation | TDDPPTTKPLTARKF CCCCCCCCCCEEEEE | 40.27 | 25825284 | |
101 | Ubiquitination | TDDPPTTKPLTARKF CCCCCCCCCCEEEEE | 40.27 | 21890473 | |
101 | Malonylation | TDDPPTTKPLTARKF CCCCCCCCCCEEEEE | 40.27 | 26320211 | |
102 | Ubiquitination | DDPPTTKPLTARKFI CCCCCCCCCEEEEEE | 32.62 | 21890473 | |
120 | Phosphorylation | HKFNVTGTPEQYVPY CCCCCCCCHHHCCCC | 17.81 | 28152594 | |
124 | Phosphorylation | VTGTPEQYVPYSTTR CCCCHHHCCCCCCCC | 11.17 | 28152594 | |
127 | Phosphorylation | TPEQYVPYSTTRKKI CHHHCCCCCCCCHHH | 14.49 | 28152594 | |
128 | Phosphorylation | PEQYVPYSTTRKKIQ HHHCCCCCCCCHHHH | 19.75 | 28152594 | |
129 | Phosphorylation | EQYVPYSTTRKKIQE HHCCCCCCCCHHHHH | 25.44 | 28152594 | |
130 | Phosphorylation | QYVPYSTTRKKIQEW HCCCCCCCCHHHHHH | 34.25 | 28152594 | |
141 | Phosphorylation | IQEWIPPSTPYK--- HHHHCCCCCCCC--- | 36.34 | 20860994 | |
142 | Phosphorylation | QEWIPPSTPYK---- HHHCCCCCCCC---- | 36.09 | 30624053 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUAC_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUAC_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
256000 | Leigh syndrome (LS) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...