dbPTM

NDUS4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NDUS4_HUMAN
UniProt AC	O43181
Protein Name	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
Gene Name	NDUFS4
Organism	Homo sapiens (Human).
Sequence Length	175
Subcellular Localization	Mitochondrion inner membrane Peripheral membrane protein Matrix side .
Protein Description	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone..
Protein Sequence	MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MAAVSMSVVLRQTL -CCCCCHHHHHHHHH	11.10	25690035
26	Phosphorylation	AVAVAALSVSRVPTR HHHHHHHCCCCCCCC	17.20	24719451
32	Phosphorylation	LSVSRVPTRSLRTST HCCCCCCCCCCCCCC	29.99	16094384
34	Phosphorylation	VSRVPTRSLRTSTWR CCCCCCCCCCCCCEE	25.36	16094384
95	2-Hydroxyisobutyrylation	QSGVNNTKKWKMEFD CCCCCCCCCEEEEEC	59.78	-
129	Phosphorylation	SNMVLTFSTKEDAVS HCCEEEEECHHHHHH	33.08	23532336
136	Phosphorylation	STKEDAVSFAEKNGW ECHHHHHHHHHHHCC	22.06	24719451
157	Phosphorylation	RKVPKPKSKSYGANF CCCCCCCCCCCCCCC	35.05	20068231
159	Phosphorylation	VPKPKSKSYGANFSW CCCCCCCCCCCCCCC	35.57	20068231
160	Phosphorylation	PKPKSKSYGANFSWN CCCCCCCCCCCCCCC	24.80	29496907
165	Phosphorylation	KSYGANFSWNKRTRV CCCCCCCCCCCCCCC	29.55	20068231
168	Acetylation	GANFSWNKRTRVSTK CCCCCCCCCCCCCCC	49.22	2401417
173	Phosphorylation	WNKRTRVSTK----- CCCCCCCCCC-----	27.47	18291624

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
173	S	Phosphorylation	Kinase	PRKACA	P17612	GPS
173	S	Phosphorylation	Kinase	PKA	-	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NDUS4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NDUS4_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
NDUS6_HUMAN	NDUFS6	physical	22939629
NDUS7_HUMAN	NDUFS7	physical	22939629
QCR7_HUMAN	UQCRB	physical	22939629
RM15_HUMAN	MRPL15	physical	22939629
ODP2_HUMAN	DLAT	physical	22939629
RS2_HUMAN	RPS2	physical	22939629
NU188_HUMAN	NUP188	physical	22939629
PERI_HUMAN	PRPH	physical	22939629
TOM20_HUMAN	TOMM20	physical	22939629
UB2G2_HUMAN	UBE2G2	physical	21988832
ATPG_HUMAN	ATP5C1	physical	26344197
NDUV1_HUMAN	NDUFV1	physical	26344197
RL14_HUMAN	RPL14	physical	26344197
VDAC1_HUMAN	VDAC1	physical	26344197
VDAC2_HUMAN	VDAC2	physical	26344197
NDUS1_HUMAN	NDUFS1	physical	24344204
NDUA9_HUMAN	NDUFA9	physical	24344204
NDUAD_HUMAN	NDUFA13	physical	24344204
NDUV3_HUMAN	NDUFV3	physical	24344204
NDUV2_HUMAN	NDUFV2	physical	24344204
COX7R_HUMAN	COX7A2L	physical	24344204
NDUA2_HUMAN	NDUFA2	physical	24344204
NDUB8_HUMAN	NDUFB8	physical	24344204
NDUS2_HUMAN	NDUFS2	physical	24344204
NU5M_HUMAN	ND5	physical	24344204
NDUAB_HUMAN	NDUFA11	physical	24344204
NDUBA_HUMAN	NDUFB10	physical	24344204
NDUV1_HUMAN	NDUFV1	physical	24344204
NU4M_HUMAN	ND4	physical	24344204
NDUB4_HUMAN	NDUFB4	physical	24344204
NDUS3_HUMAN	NDUFS3	physical	24344204
NDUA7_HUMAN	NDUFA7	physical	24344204
NDUS8_HUMAN	NDUFS8	physical	24344204
NDUAC_HUMAN	NDUFA12	physical	24344204
NU1M_HUMAN	ND1	physical	24344204

Drug and Disease Associations

Kegg Disease
H00473	Mitochondrial respiratory chain deficiencies (MRCD), including: Mitochondrial complex I deficiency (
OMIM Disease
252010	Mitochondrial complex I deficiency (MT-C1D)
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NDUS4_HUMAN

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Quantitative phosphoproteome analysis using a dendrimer conjugationchemistry and tandem mass spectrometry."; Tao W.A., Wollscheid B., O'Brien R., Eng J.K., Li X.-J.,Bodenmiller B., Watts J.D., Hood L., Aebersold R.; Nat. Methods 2:591-598(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-32 AND SER-34, AND MASSSPECTROMETRY.	16094384 [Abstract]