UniProt ID | COX7R_HUMAN | |
---|---|---|
UniProt AC | O14548 | |
Protein Name | Cytochrome c oxidase subunit 7A-related protein, mitochondrial | |
Gene Name | COX7A2L | |
Organism | Homo sapiens (Human). | |
Sequence Length | 114 | |
Subcellular Localization | Mitochondrion inner membrane. | |
Protein Description | Involved in the regulation of oxidative phosphorylation and energy metabolism (By similarity). Necessary for the assembly of mitochondrial respiratory supercomplex (By similarity).. | |
Protein Sequence | MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Acetylation | ----MYYKFSGFTQK ----CCCCCCCHHHH | 18.63 | 25825284 | |
11 | Ubiquitination | KFSGFTQKLAGAWAS CCCCHHHHHHHHHHC | 36.93 | 21890473 | |
27 | Ubiquitination | AYSPQGLKPVVSTEA CCCCCCCCCCCCCCC | 42.46 | - | |
46 | Phosphorylation | FATPTKLTSDSTVYD EECCCCCCCCCCCCC | 31.85 | 28111955 | |
47 | Phosphorylation | ATPTKLTSDSTVYDY ECCCCCCCCCCCCCC | 39.75 | 28111955 | |
49 | Phosphorylation | PTKLTSDSTVYDYAG CCCCCCCCCCCCCCC | 21.38 | 28152594 | |
50 | Phosphorylation | TKLTSDSTVYDYAGK CCCCCCCCCCCCCCC | 28.24 | 28152594 | |
52 | Phosphorylation | LTSDSTVYDYAGKNK CCCCCCCCCCCCCCC | 11.88 | 25884760 | |
54 | Phosphorylation | SDSTVYDYAGKNKVP CCCCCCCCCCCCCCH | 10.28 | 28152594 | |
57 | Ubiquitination | TVYDYAGKNKVPELQ CCCCCCCCCCCHHHH | 45.48 | - | |
65 | Acetylation | NKVPELQKFFQKADG CCCHHHHHHHHHCCC | 61.85 | 25038526 | |
69 | Ubiquitination | ELQKFFQKADGVPVY HHHHHHHHCCCCEEE | 43.20 | 19608861 | |
69 | Acetylation | ELQKFFQKADGVPVY HHHHHHHHCCCCEEE | 43.20 | 19608861 | |
69 | Malonylation | ELQKFFQKADGVPVY HHHHHHHHCCCCEEE | 43.20 | 32601280 | |
69 | Succinylation | ELQKFFQKADGVPVY HHHHHHHHCCCCEEE | 43.20 | 23954790 | |
78 | Ubiquitination | DGVPVYLKRGLPDQM CCCEEEECCCCCHHH | 27.08 | - | |
78 | 2-Hydroxyisobutyrylation | DGVPVYLKRGLPDQM CCCEEEECCCCCHHH | 27.08 | - | |
87 | Phosphorylation | GLPDQMLYRTTMALT CCCHHHHHHHHHHHH | 10.69 | 20068231 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX7R_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX7R_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX7R_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
U2AF2_HUMAN | U2AF2 | physical | 22939629 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-69, AND MASS SPECTROMETRY. |